Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies




| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SVLLMKPDAELSASSVYNLLPEKDLTGFPGPLNDQDDEDCINRHNVYINGITYTPVSSTNEKDMYSFLEDMGLKAFTNSKIRKPKMCPQLQQYEMHGPEGLRVGFYESDVMGRGHARLVHVEEPHTETVRKYFPETWIWDLVVVNS |
| Gene Sequence | SVLLMKPDAELSASSVYNLLPEKDLTGFPGPLNDQDDEDCINRHNVYINGITYTPVSSTNEKDMYSFLEDMGLKAFTNSKIRKPKMCPQLQQYEMHGPEGLRVGFYESDVMGRGHARLVHVEEPHTETVRKYFPETWIWDLVVVNS |
| Gene ID - Mouse | ENSMUSG00000030111 |
| Gene ID - Rat | ENSRNOG00000045772 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti A2M pAb (ATL-HPA002265) | |
| Datasheet | Anti A2M pAb (ATL-HPA002265) Datasheet (External Link) |
| Vendor Page | Anti A2M pAb (ATL-HPA002265) at Atlas Antibodies |
| Documents & Links for Anti A2M pAb (ATL-HPA002265) | |
| Datasheet | Anti A2M pAb (ATL-HPA002265) Datasheet (External Link) |
| Vendor Page | Anti A2M pAb (ATL-HPA002265) |
| Citations for Anti A2M pAb (ATL-HPA002265) – 5 Found |
| Häggmark, Anna; Neiman, Maja; Drobin, Kimi; Zwahlen, Martin; Uhlén, Mathias; Nilsson, Peter; Schwenk, Jochen M. Classification of protein profiles from antibody microarrays using heat and detergent treatment. New Biotechnology. 2012;29(5):564-70. PubMed |
| Kato, Bernet S; Nicholson, George; Neiman, Maja; Rantalainen, Mattias; Holmes, Chris C; Barrett, Amy; Uhlén, Mathias; Nilsson, Peter; Spector, Tim D; Schwenk, Jochen M. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Science. 2011;9( 22093360):73. PubMed |
| Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476. PubMed |
| Jaldín-Fincati, Javier R; Actis Dato, Virginia; Díaz, Nicolás M; Sánchez, María C; Barcelona, Pablo F; Chiabrando, Gustavo A. Activated α(2)-Macroglobulin Regulates LRP1 Levels at the Plasma Membrane through the Activation of a Rab10-dependent Exocytic Pathway in Retinal Müller Glial Cells. Scientific Reports. 2019;9(1):13234. PubMed |
| Yang, Andrew C; Vest, Ryan T; Kern, Fabian; Lee, Davis P; Agam, Maayan; Maat, Christina A; Losada, Patricia M; Chen, Michelle B; Schaum, Nicholas; Khoury, Nathalie; Toland, Angus; Calcuttawala, Kruti; Shin, Heather; Pálovics, Róbert; Shin, Andrew; Wang, Elizabeth Y; Luo, Jian; Gate, David; Schulz-Schaeffer, Walter J; Chu, Pauline; Siegenthaler, Julie A; McNerney, M Windy; Keller, Andreas; Wyss-Coray, Tony. A human brain vascular atlas reveals diverse mediators of Alzheimer's risk. Nature. 2022;603(7903):885-892. PubMed |




| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SVLLMKPDAELSASSVYNLLPEKDLTGFPGPLNDQDDEDCINRHNVYINGITYTPVSSTNEKDMYSFLEDMGLKAFTNSKIRKPKMCPQLQQYEMHGPEGLRVGFYESDVMGRGHARLVHVEEPHTETVRKYFPETWIWDLVVVNS |
| Gene Sequence | SVLLMKPDAELSASSVYNLLPEKDLTGFPGPLNDQDDEDCINRHNVYINGITYTPVSSTNEKDMYSFLEDMGLKAFTNSKIRKPKMCPQLQQYEMHGPEGLRVGFYESDVMGRGHARLVHVEEPHTETVRKYFPETWIWDLVVVNS |
| Gene ID - Mouse | ENSMUSG00000030111 |
| Gene ID - Rat | ENSRNOG00000045772 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti A2M pAb (ATL-HPA002265) | |
| Datasheet | Anti A2M pAb (ATL-HPA002265) Datasheet (External Link) |
| Vendor Page | Anti A2M pAb (ATL-HPA002265) at Atlas Antibodies |
| Documents & Links for Anti A2M pAb (ATL-HPA002265) | |
| Datasheet | Anti A2M pAb (ATL-HPA002265) Datasheet (External Link) |
| Vendor Page | Anti A2M pAb (ATL-HPA002265) |
| Citations for Anti A2M pAb (ATL-HPA002265) – 5 Found |
| Häggmark, Anna; Neiman, Maja; Drobin, Kimi; Zwahlen, Martin; Uhlén, Mathias; Nilsson, Peter; Schwenk, Jochen M. Classification of protein profiles from antibody microarrays using heat and detergent treatment. New Biotechnology. 2012;29(5):564-70. PubMed |
| Kato, Bernet S; Nicholson, George; Neiman, Maja; Rantalainen, Mattias; Holmes, Chris C; Barrett, Amy; Uhlén, Mathias; Nilsson, Peter; Spector, Tim D; Schwenk, Jochen M. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Science. 2011;9( 22093360):73. PubMed |
| Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476. PubMed |
| Jaldín-Fincati, Javier R; Actis Dato, Virginia; Díaz, Nicolás M; Sánchez, María C; Barcelona, Pablo F; Chiabrando, Gustavo A. Activated α(2)-Macroglobulin Regulates LRP1 Levels at the Plasma Membrane through the Activation of a Rab10-dependent Exocytic Pathway in Retinal Müller Glial Cells. Scientific Reports. 2019;9(1):13234. PubMed |
| Yang, Andrew C; Vest, Ryan T; Kern, Fabian; Lee, Davis P; Agam, Maayan; Maat, Christina A; Losada, Patricia M; Chen, Michelle B; Schaum, Nicholas; Khoury, Nathalie; Toland, Angus; Calcuttawala, Kruti; Shin, Heather; Pálovics, Róbert; Shin, Andrew; Wang, Elizabeth Y; Luo, Jian; Gate, David; Schulz-Schaeffer, Walter J; Chu, Pauline; Siegenthaler, Julie A; McNerney, M Windy; Keller, Andreas; Wyss-Coray, Tony. A human brain vascular atlas reveals diverse mediators of Alzheimer's risk. Nature. 2022;603(7903):885-892. PubMed |