Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GGASNTTDAQVDSIVDPMLDLDIQELASLTTGGGDVENFERLFSKLKEMKDKAATLPHEQRKVHAEKVAKAFWMAIG |
| Gene Sequence | GGASNTTDAQVDSIVDPMLDLDIQELASLTTGGGDVENFERLFSKLKEMKDKAATLPHEQRKVHAEKVAKAFWMAIG |
| Gene ID - Mouse | ENSMUSG00000037257 |
| Gene ID - Rat | ENSRNOG00000008424 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AAGAB pAb (ATL-HPA040174) | |
| Datasheet | Anti AAGAB pAb (ATL-HPA040174) Datasheet (External Link) |
| Vendor Page | Anti AAGAB pAb (ATL-HPA040174) at Atlas Antibodies |
| Documents & Links for Anti AAGAB pAb (ATL-HPA040174) | |
| Datasheet | Anti AAGAB pAb (ATL-HPA040174) Datasheet (External Link) |
| Vendor Page | Anti AAGAB pAb (ATL-HPA040174) |
| Citations for Anti AAGAB pAb (ATL-HPA040174) – 2 Found |
| Pohler, Elizabeth; Mamai, Ons; Hirst, Jennifer; Zamiri, Mozheh; Horn, Helen; Nomura, Toshifumi; Irvine, Alan D; Moran, Benvon; Wilson, Neil J; Smith, Frances J D; Goh, Christabelle S M; Sandilands, Aileen; Cole, Christian; Barton, Geoffrey J; Evans, Alan T; Shimizu, Hiroshi; Akiyama, Masashi; Suehiro, Mitsuhiro; Konohana, Izumi; Shboul, Mohammad; Teissier, Sebastien; Boussofara, Lobna; Denguezli, Mohamed; Saad, Ali; Gribaa, Moez; Dopping-Hepenstal, Patricia J; McGrath, John A; Brown, Sara J; Goudie, David R; Reversade, Bruno; Munro, Colin S; McLean, W H Irwin. Haploinsufficiency for AAGAB causes clinically heterogeneous forms of punctate palmoplantar keratoderma. Nature Genetics. 2012;44(11):1272-6. PubMed |
| Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. PubMed |
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GGASNTTDAQVDSIVDPMLDLDIQELASLTTGGGDVENFERLFSKLKEMKDKAATLPHEQRKVHAEKVAKAFWMAIG |
| Gene Sequence | GGASNTTDAQVDSIVDPMLDLDIQELASLTTGGGDVENFERLFSKLKEMKDKAATLPHEQRKVHAEKVAKAFWMAIG |
| Gene ID - Mouse | ENSMUSG00000037257 |
| Gene ID - Rat | ENSRNOG00000008424 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AAGAB pAb (ATL-HPA040174) | |
| Datasheet | Anti AAGAB pAb (ATL-HPA040174) Datasheet (External Link) |
| Vendor Page | Anti AAGAB pAb (ATL-HPA040174) at Atlas Antibodies |
| Documents & Links for Anti AAGAB pAb (ATL-HPA040174) | |
| Datasheet | Anti AAGAB pAb (ATL-HPA040174) Datasheet (External Link) |
| Vendor Page | Anti AAGAB pAb (ATL-HPA040174) |
| Citations for Anti AAGAB pAb (ATL-HPA040174) – 2 Found |
| Pohler, Elizabeth; Mamai, Ons; Hirst, Jennifer; Zamiri, Mozheh; Horn, Helen; Nomura, Toshifumi; Irvine, Alan D; Moran, Benvon; Wilson, Neil J; Smith, Frances J D; Goh, Christabelle S M; Sandilands, Aileen; Cole, Christian; Barton, Geoffrey J; Evans, Alan T; Shimizu, Hiroshi; Akiyama, Masashi; Suehiro, Mitsuhiro; Konohana, Izumi; Shboul, Mohammad; Teissier, Sebastien; Boussofara, Lobna; Denguezli, Mohamed; Saad, Ali; Gribaa, Moez; Dopping-Hepenstal, Patricia J; McGrath, John A; Brown, Sara J; Goudie, David R; Reversade, Bruno; Munro, Colin S; McLean, W H Irwin. Haploinsufficiency for AAGAB causes clinically heterogeneous forms of punctate palmoplantar keratoderma. Nature Genetics. 2012;44(11):1272-6. PubMed |
| Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. PubMed |