Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies




| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFLRTYASTEQEQDAEENGVTGVSGPGKEAKQMENGMLVTDSAGKQLQRQLSSSSSYSGDISRHHNSTAELQKAEAKKEETWKLMEADKAQTGQVKLSVYWD |
| Gene Sequence | LVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFLRTYASTEQEQDAEENGVTGVSGPGKEAKQMENGMLVTDSAGKQLQRQLSSSSSYSGDISRHHNSTAELQKAEAKKEETWKLMEADKAQTGQVKLSVYWD |
| Gene ID - Mouse | ENSMUSG00000023088 |
| Gene ID - Rat | ENSRNOG00000022305 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ABCC1 pAb (ATL-HPA002380) | |
| Datasheet | Anti ABCC1 pAb (ATL-HPA002380) Datasheet (External Link) |
| Vendor Page | Anti ABCC1 pAb (ATL-HPA002380) at Atlas Antibodies |
| Documents & Links for Anti ABCC1 pAb (ATL-HPA002380) | |
| Datasheet | Anti ABCC1 pAb (ATL-HPA002380) Datasheet (External Link) |
| Vendor Page | Anti ABCC1 pAb (ATL-HPA002380) |
| Citations for Anti ABCC1 pAb (ATL-HPA002380) – 3 Found |
| Bernstein, Hans-Gert; Hölzl, Gloria; Dobrowolny, Henrik; Hildebrandt, Jens; Trübner, Kurt; Krohn, Markus; Bogerts, Bernhard; Pahnke, Jens. Vascular and extravascular distribution of the ATP-binding cassette transporters ABCB1 and ABCC1 in aged human brain and pituitary. Mechanisms Of Ageing And Development. 2014;141-142( 25218792):12-21. PubMed |
| Veringa, Susanna J E; Biesmans, Dennis; van Vuurden, Dannis G; Jansen, Marc H A; Wedekind, Laurine E; Horsman, Ilona; Wesseling, Pieter; Vandertop, William Peter; Noske, David P; Kaspers, GertJan J L; Hulleman, Esther. In vitro drug response and efflux transporters associated with drug resistance in pediatric high grade glioma and diffuse intrinsic pontine glioma. Plos One. 8(4):e61512. PubMed |
| Silva, Virgílio Souza E; Abdallah, Emne Ali; Brito, Angelo Borsarelli Carvalho de; Braun, Alexcia Camila; Tariki, Milena Shizue; de Mello, Celso Abdon Lopes; Calsavara, Vinicius Fernando; Riechelmann, Rachel; Chinen, Ludmilla Thomé Domingos. Baseline and Kinetic Circulating Tumor Cell Counts Are Prognostic Factors in a Prospective Study of Metastatic Colorectal Cancer. Diagnostics (Basel, Switzerland). 2021;11(3) PubMed |




| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFLRTYASTEQEQDAEENGVTGVSGPGKEAKQMENGMLVTDSAGKQLQRQLSSSSSYSGDISRHHNSTAELQKAEAKKEETWKLMEADKAQTGQVKLSVYWD |
| Gene Sequence | LVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFLRTYASTEQEQDAEENGVTGVSGPGKEAKQMENGMLVTDSAGKQLQRQLSSSSSYSGDISRHHNSTAELQKAEAKKEETWKLMEADKAQTGQVKLSVYWD |
| Gene ID - Mouse | ENSMUSG00000023088 |
| Gene ID - Rat | ENSRNOG00000022305 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ABCC1 pAb (ATL-HPA002380) | |
| Datasheet | Anti ABCC1 pAb (ATL-HPA002380) Datasheet (External Link) |
| Vendor Page | Anti ABCC1 pAb (ATL-HPA002380) at Atlas Antibodies |
| Documents & Links for Anti ABCC1 pAb (ATL-HPA002380) | |
| Datasheet | Anti ABCC1 pAb (ATL-HPA002380) Datasheet (External Link) |
| Vendor Page | Anti ABCC1 pAb (ATL-HPA002380) |
| Citations for Anti ABCC1 pAb (ATL-HPA002380) – 3 Found |
| Bernstein, Hans-Gert; Hölzl, Gloria; Dobrowolny, Henrik; Hildebrandt, Jens; Trübner, Kurt; Krohn, Markus; Bogerts, Bernhard; Pahnke, Jens. Vascular and extravascular distribution of the ATP-binding cassette transporters ABCB1 and ABCC1 in aged human brain and pituitary. Mechanisms Of Ageing And Development. 2014;141-142( 25218792):12-21. PubMed |
| Veringa, Susanna J E; Biesmans, Dennis; van Vuurden, Dannis G; Jansen, Marc H A; Wedekind, Laurine E; Horsman, Ilona; Wesseling, Pieter; Vandertop, William Peter; Noske, David P; Kaspers, GertJan J L; Hulleman, Esther. In vitro drug response and efflux transporters associated with drug resistance in pediatric high grade glioma and diffuse intrinsic pontine glioma. Plos One. 8(4):e61512. PubMed |
| Silva, Virgílio Souza E; Abdallah, Emne Ali; Brito, Angelo Borsarelli Carvalho de; Braun, Alexcia Camila; Tariki, Milena Shizue; de Mello, Celso Abdon Lopes; Calsavara, Vinicius Fernando; Riechelmann, Rachel; Chinen, Ludmilla Thomé Domingos. Baseline and Kinetic Circulating Tumor Cell Counts Are Prognostic Factors in a Prospective Study of Metastatic Colorectal Cancer. Diagnostics (Basel, Switzerland). 2021;11(3) PubMed |