Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DLSTATKSKTSEDISQTSKYSPIYSPDPYYASESEYWTYHGSPKVPRARRFSSGGEEDDFDRSMHKLQSGIGRLILKEEMKARSSSYADPWTPPRSSTSSREALHTAGYEMSLNGSPRSHYLADSDPLISKSASLPAYRRNGLHRT |
| Gene Sequence | DLSTATKSKTSEDISQTSKYSPIYSPDPYYASESEYWTYHGSPKVPRARRFSSGGEEDDFDRSMHKLQSGIGRLILKEEMKARSSSYADPWTPPRSSTSSREALHTAGYEMSLNGSPRSHYLADSDPLISKSASLPAYRRNGLHRT |
| Gene ID - Mouse | ENSMUSG00000032735 |
| Gene ID - Rat | ENSRNOG00000019365 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ABLIM3 pAb (ATL-HPA003245) | |
| Datasheet | Anti ABLIM3 pAb (ATL-HPA003245) Datasheet (External Link) |
| Vendor Page | Anti ABLIM3 pAb (ATL-HPA003245) at Atlas Antibodies |
| Documents & Links for Anti ABLIM3 pAb (ATL-HPA003245) | |
| Datasheet | Anti ABLIM3 pAb (ATL-HPA003245) Datasheet (External Link) |
| Vendor Page | Anti ABLIM3 pAb (ATL-HPA003245) |
| Citations for Anti ABLIM3 pAb (ATL-HPA003245) – 4 Found |
| Li, Amy; Ponten, Fredrik; dos Remedios, Cristobal G. The interactome of LIM domain proteins: the contributions of LIM domain proteins to heart failure and heart development. Proteomics. 2012;12(2):203-25. PubMed |
| Cao, Jingli; Shen, Yidong; Zhu, Lei; Xu, Yanan; Zhou, Yizhuo; Wu, Zhili; Li, Yiping; Yan, Xiumin; Zhu, Xueliang. miR-129-3p controls cilia assembly by regulating CP110 and actin dynamics. Nature Cell Biology. 2012;14(7):697-706. PubMed |
| Lee, Jandee; Jeong, Seonhyang; Lee, Cho Rok; Ku, Cheol Ryong; Kang, Sang-Wook; Jeong, Jong Ju; Nam, Kee-Hyun; Shin, Dong Yeob; Chung, Woong Youn; Lee, Eun Jig; Jo, Young Suk. GLI1 Transcription Factor Affects Tumor Aggressiveness in Patients With Papillary Thyroid Cancers. Medicine. 2015;94(25):e998. PubMed |
| Fearnley, Gareth W; Young, Katherine A; Edgar, James R; Antrobus, Robin; Hay, Iain M; Liang, Wei-Ching; Martinez-Martin, Nadia; Lin, WeiYu; Deane, Janet E; Sharpe, Hayley J. The homophilic receptor PTPRK selectively dephosphorylates multiple junctional regulators to promote cell-cell adhesion. Elife. 2019;8( 30924770) PubMed |
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DLSTATKSKTSEDISQTSKYSPIYSPDPYYASESEYWTYHGSPKVPRARRFSSGGEEDDFDRSMHKLQSGIGRLILKEEMKARSSSYADPWTPPRSSTSSREALHTAGYEMSLNGSPRSHYLADSDPLISKSASLPAYRRNGLHRT |
| Gene Sequence | DLSTATKSKTSEDISQTSKYSPIYSPDPYYASESEYWTYHGSPKVPRARRFSSGGEEDDFDRSMHKLQSGIGRLILKEEMKARSSSYADPWTPPRSSTSSREALHTAGYEMSLNGSPRSHYLADSDPLISKSASLPAYRRNGLHRT |
| Gene ID - Mouse | ENSMUSG00000032735 |
| Gene ID - Rat | ENSRNOG00000019365 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ABLIM3 pAb (ATL-HPA003245) | |
| Datasheet | Anti ABLIM3 pAb (ATL-HPA003245) Datasheet (External Link) |
| Vendor Page | Anti ABLIM3 pAb (ATL-HPA003245) at Atlas Antibodies |
| Documents & Links for Anti ABLIM3 pAb (ATL-HPA003245) | |
| Datasheet | Anti ABLIM3 pAb (ATL-HPA003245) Datasheet (External Link) |
| Vendor Page | Anti ABLIM3 pAb (ATL-HPA003245) |
| Citations for Anti ABLIM3 pAb (ATL-HPA003245) – 4 Found |
| Li, Amy; Ponten, Fredrik; dos Remedios, Cristobal G. The interactome of LIM domain proteins: the contributions of LIM domain proteins to heart failure and heart development. Proteomics. 2012;12(2):203-25. PubMed |
| Cao, Jingli; Shen, Yidong; Zhu, Lei; Xu, Yanan; Zhou, Yizhuo; Wu, Zhili; Li, Yiping; Yan, Xiumin; Zhu, Xueliang. miR-129-3p controls cilia assembly by regulating CP110 and actin dynamics. Nature Cell Biology. 2012;14(7):697-706. PubMed |
| Lee, Jandee; Jeong, Seonhyang; Lee, Cho Rok; Ku, Cheol Ryong; Kang, Sang-Wook; Jeong, Jong Ju; Nam, Kee-Hyun; Shin, Dong Yeob; Chung, Woong Youn; Lee, Eun Jig; Jo, Young Suk. GLI1 Transcription Factor Affects Tumor Aggressiveness in Patients With Papillary Thyroid Cancers. Medicine. 2015;94(25):e998. PubMed |
| Fearnley, Gareth W; Young, Katherine A; Edgar, James R; Antrobus, Robin; Hay, Iain M; Liang, Wei-Ching; Martinez-Martin, Nadia; Lin, WeiYu; Deane, Janet E; Sharpe, Hayley J. The homophilic receptor PTPRK selectively dephosphorylates multiple junctional regulators to promote cell-cell adhesion. Elife. 2019;8( 30924770) PubMed |