Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies






| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVNRQCSSGLQAVASIAGGIRNGSYDIGMACGVESMSLADRGNPGNITSRLMEKEKARDCLIPMGITSENVAERFGISREKQ |
| Gene Sequence | VLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVNRQCSSGLQAVASIAGGIRNGSYDIGMACGVESMSLADRGNPGNITSRLMEKEKARDCLIPMGITSENVAERFGISREKQ |
| Gene ID - Mouse | ENSMUSG00000010651 |
| Gene ID - Rat | ENSRNOG00000032908 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ACAA1 pAb (ATL-HPA007244 w/enhanced validation) | |
| Datasheet | Anti ACAA1 pAb (ATL-HPA007244 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ACAA1 pAb (ATL-HPA007244 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ACAA1 pAb (ATL-HPA007244 w/enhanced validation) | |
| Datasheet | Anti ACAA1 pAb (ATL-HPA007244 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ACAA1 pAb (ATL-HPA007244 w/enhanced validation) |
| Citations for Anti ACAA1 pAb (ATL-HPA007244 w/enhanced validation) – 8 Found |
| Klouwer, Femke C C; Koster, Janet; Ferdinandusse, Sacha; Waterham, Hans R. Peroxisomal abnormalities in the immortalized human hepatocyte (IHH) cell line. Histochemistry And Cell Biology. 2017;147(4):537-541. PubMed |
| Falkenberg, Kim D; Braverman, Nancy E; Moser, Ann B; Steinberg, Steven J; Klouwer, Femke C C; Schlüter, Agatha; Ruiz, Montserrat; Pujol, Aurora; Engvall, Martin; Naess, Karin; van Spronsen, FrancJan; Körver-Keularts, Irene; Rubio-Gozalbo, M Estela; Ferdinandusse, Sacha; Wanders, Ronald J A; Waterham, Hans R. Allelic Expression Imbalance Promoting a Mutant PEX6 Allele Causes Zellweger Spectrum Disorder. American Journal Of Human Genetics. 2017;101(6):965-976. PubMed |
| Torres, Sandra Elizabeth; Gallagher, Ciara M; Plate, Lars; Gupta, Meghna; Liem, Christina R; Guo, Xiaoyan; Tian, Ruilin; Stroud, Robert M; Kampmann, Martin; Weissman, Jonathan S; Walter, Peter. Ceapins block the unfolded protein response sensor ATF6α by inducing a neomorphic inter-organelle tether. Elife. 2019;8( 31149896) PubMed |
| de la Calle Arregui, Celia; Plata-Gómez, Ana Belén; Deleyto-Seldas, Nerea; García, Fernando; Ortega-Molina, Ana; Abril-Garrido, Julio; Rodriguez, Elena; Nemazanyy, Ivan; Tribouillard, Laura; de Martino, Alba; Caleiras, Eduardo; Campos-Olivas, Ramón; Mulero, Francisca; Laplante, Mathieu; Muñoz, Javier; Pende, Mario; Sabio, Guadalupe; Sabatini, David M; Efeyan, Alejo. Limited survival and impaired hepatic fasting metabolism in mice with constitutive Rag GTPase signaling. Nature Communications. 2021;12(1):3660. PubMed |
| da Silva, Tiago Ferreira; Eira, Jessica; Lopes, André T; Malheiro, Ana R; Sousa, Vera; Luoma, Adrienne; Avila, Robin L; Wanders, Ronald J A; Just, Wilhelm W; Kirschner, Daniel A; Sousa, Mónica M; Brites, Pedro. Peripheral nervous system plasmalogens regulate Schwann cell differentiation and myelination. The Journal Of Clinical Investigation. 2014;124(6):2560-70. PubMed |
| Moruno-Manchon, Jose F; Uzor, Ndidi-Ese; Kesler, Shelli R; Wefel, Jeffrey S; Townley, Debra M; Nagaraja, Archana Sidalaghatta; Pradeep, Sunila; Mangala, Lingegowda S; Sood, Anil K; Tsvetkov, Andrey S. Peroxisomes contribute to oxidative stress in neurons during doxorubicin-based chemotherapy. Molecular And Cellular Neurosciences. 2018;86( 29180229):65-71. PubMed |
| Zhang, Xiuzhi; Yang, Hongmei; Zhang, Jinzhong; Gao, Fenglan; Dai, Liping. HSD17B4, ACAA1, and PXMP4 in Peroxisome Pathway Are Down-Regulated and Have Clinical Significance in Non-small Cell Lung Cancer. Frontiers In Genetics. 11( 32265992):273. PubMed |
| Klouwer, Femke C C; Falkenberg, Kim D; Ofman, Rob; Koster, Janet; van Gent, Démi; Ferdinandusse, Sacha; Wanders, Ronald J A; Waterham, Hans R. Autophagy Inhibitors Do Not Restore Peroxisomal Functions in Cells With the Most Common Peroxisome Biogenesis Defect. Frontiers In Cell And Developmental Biology. 9( 33869228):661298. PubMed |






| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVNRQCSSGLQAVASIAGGIRNGSYDIGMACGVESMSLADRGNPGNITSRLMEKEKARDCLIPMGITSENVAERFGISREKQ |
| Gene Sequence | VLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVNRQCSSGLQAVASIAGGIRNGSYDIGMACGVESMSLADRGNPGNITSRLMEKEKARDCLIPMGITSENVAERFGISREKQ |
| Gene ID - Mouse | ENSMUSG00000010651 |
| Gene ID - Rat | ENSRNOG00000032908 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ACAA1 pAb (ATL-HPA007244 w/enhanced validation) | |
| Datasheet | Anti ACAA1 pAb (ATL-HPA007244 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ACAA1 pAb (ATL-HPA007244 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ACAA1 pAb (ATL-HPA007244 w/enhanced validation) | |
| Datasheet | Anti ACAA1 pAb (ATL-HPA007244 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ACAA1 pAb (ATL-HPA007244 w/enhanced validation) |
| Citations for Anti ACAA1 pAb (ATL-HPA007244 w/enhanced validation) – 8 Found |
| Klouwer, Femke C C; Koster, Janet; Ferdinandusse, Sacha; Waterham, Hans R. Peroxisomal abnormalities in the immortalized human hepatocyte (IHH) cell line. Histochemistry And Cell Biology. 2017;147(4):537-541. PubMed |
| Falkenberg, Kim D; Braverman, Nancy E; Moser, Ann B; Steinberg, Steven J; Klouwer, Femke C C; Schlüter, Agatha; Ruiz, Montserrat; Pujol, Aurora; Engvall, Martin; Naess, Karin; van Spronsen, FrancJan; Körver-Keularts, Irene; Rubio-Gozalbo, M Estela; Ferdinandusse, Sacha; Wanders, Ronald J A; Waterham, Hans R. Allelic Expression Imbalance Promoting a Mutant PEX6 Allele Causes Zellweger Spectrum Disorder. American Journal Of Human Genetics. 2017;101(6):965-976. PubMed |
| Torres, Sandra Elizabeth; Gallagher, Ciara M; Plate, Lars; Gupta, Meghna; Liem, Christina R; Guo, Xiaoyan; Tian, Ruilin; Stroud, Robert M; Kampmann, Martin; Weissman, Jonathan S; Walter, Peter. Ceapins block the unfolded protein response sensor ATF6α by inducing a neomorphic inter-organelle tether. Elife. 2019;8( 31149896) PubMed |
| de la Calle Arregui, Celia; Plata-Gómez, Ana Belén; Deleyto-Seldas, Nerea; García, Fernando; Ortega-Molina, Ana; Abril-Garrido, Julio; Rodriguez, Elena; Nemazanyy, Ivan; Tribouillard, Laura; de Martino, Alba; Caleiras, Eduardo; Campos-Olivas, Ramón; Mulero, Francisca; Laplante, Mathieu; Muñoz, Javier; Pende, Mario; Sabio, Guadalupe; Sabatini, David M; Efeyan, Alejo. Limited survival and impaired hepatic fasting metabolism in mice with constitutive Rag GTPase signaling. Nature Communications. 2021;12(1):3660. PubMed |
| da Silva, Tiago Ferreira; Eira, Jessica; Lopes, André T; Malheiro, Ana R; Sousa, Vera; Luoma, Adrienne; Avila, Robin L; Wanders, Ronald J A; Just, Wilhelm W; Kirschner, Daniel A; Sousa, Mónica M; Brites, Pedro. Peripheral nervous system plasmalogens regulate Schwann cell differentiation and myelination. The Journal Of Clinical Investigation. 2014;124(6):2560-70. PubMed |
| Moruno-Manchon, Jose F; Uzor, Ndidi-Ese; Kesler, Shelli R; Wefel, Jeffrey S; Townley, Debra M; Nagaraja, Archana Sidalaghatta; Pradeep, Sunila; Mangala, Lingegowda S; Sood, Anil K; Tsvetkov, Andrey S. Peroxisomes contribute to oxidative stress in neurons during doxorubicin-based chemotherapy. Molecular And Cellular Neurosciences. 2018;86( 29180229):65-71. PubMed |
| Zhang, Xiuzhi; Yang, Hongmei; Zhang, Jinzhong; Gao, Fenglan; Dai, Liping. HSD17B4, ACAA1, and PXMP4 in Peroxisome Pathway Are Down-Regulated and Have Clinical Significance in Non-small Cell Lung Cancer. Frontiers In Genetics. 11( 32265992):273. PubMed |
| Klouwer, Femke C C; Falkenberg, Kim D; Ofman, Rob; Koster, Janet; van Gent, Démi; Ferdinandusse, Sacha; Wanders, Ronald J A; Waterham, Hans R. Autophagy Inhibitors Do Not Restore Peroxisomal Functions in Cells With the Most Common Peroxisome Biogenesis Defect. Frontiers In Cell And Developmental Biology. 9( 33869228):661298. PubMed |