Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies

![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/59054/48471/atl-hpa063018_anti-acaca-pab-atl-hpa063018_60036__32142.1783644499.jpg?compression=lossy)

![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/59054/48471/atl-hpa063018_anti-acaca-pab-atl-hpa063018_60036__32142.1783644499.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MDEPSPLAQPLELNQHSRFIIGSVSEDNSEDEISNLVKLDLLEEKEGSLSPASVGSDTLSDL |
| Gene Sequence | MDEPSPLAQPLELNQHSRFIIGSVSEDNSEDEISNLVKLDLLEEKEGSLSPASVGSDTLSDL |
| Gene ID - Mouse | ENSMUSG00000020532 |
| Gene ID - Rat | ENSRNOG00000008237 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ACACA pAb (ATL-HPA063018) | |
| Datasheet | Anti ACACA pAb (ATL-HPA063018) Datasheet (External Link) |
| Vendor Page | Anti ACACA pAb (ATL-HPA063018) at Atlas Antibodies |
| Documents & Links for Anti ACACA pAb (ATL-HPA063018) | |
| Datasheet | Anti ACACA pAb (ATL-HPA063018) Datasheet (External Link) |
| Vendor Page | Anti ACACA pAb (ATL-HPA063018) |
| Citations for Anti ACACA pAb (ATL-HPA063018) – 1 Found |
| Xiahou, Zhikai; Han, Jun. Effects of dehydroabietic acid on nontarget lipidomics and proteomics of HepG2. Frontiers In Pharmacology. 13( 36532744):1015240. PubMed |

![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/59054/48471/atl-hpa063018_anti-acaca-pab-atl-hpa063018_60036__32142.1783644499.jpg?compression=lossy)

![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/59054/48471/atl-hpa063018_anti-acaca-pab-atl-hpa063018_60036__32142.1783644499.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MDEPSPLAQPLELNQHSRFIIGSVSEDNSEDEISNLVKLDLLEEKEGSLSPASVGSDTLSDL |
| Gene Sequence | MDEPSPLAQPLELNQHSRFIIGSVSEDNSEDEISNLVKLDLLEEKEGSLSPASVGSDTLSDL |
| Gene ID - Mouse | ENSMUSG00000020532 |
| Gene ID - Rat | ENSRNOG00000008237 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ACACA pAb (ATL-HPA063018) | |
| Datasheet | Anti ACACA pAb (ATL-HPA063018) Datasheet (External Link) |
| Vendor Page | Anti ACACA pAb (ATL-HPA063018) at Atlas Antibodies |
| Documents & Links for Anti ACACA pAb (ATL-HPA063018) | |
| Datasheet | Anti ACACA pAb (ATL-HPA063018) Datasheet (External Link) |
| Vendor Page | Anti ACACA pAb (ATL-HPA063018) |
| Citations for Anti ACACA pAb (ATL-HPA063018) – 1 Found |
| Xiahou, Zhikai; Han, Jun. Effects of dehydroabietic acid on nontarget lipidomics and proteomics of HepG2. Frontiers In Pharmacology. 13( 36532744):1015240. PubMed |