Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
Atlas Antibodies
Atlas Antibodies


| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ELFPVDVMRKAAQLGFGGVYIQTDVGGSGLSRLDTSVIFEALATGCTSTTAYISIHNMCAWMIDSFGNEEQRHKFCPPL |
| Gene Sequence | ELFPVDVMRKAAQLGFGGVYIQTDVGGSGLSRLDTSVIFEALATGCTSTTAYISIHNMCAWMIDSFGNEEQRHKFCPPL |
| Gene ID - Mouse | ENSMUSG00000031969 |
| Gene ID - Rat | ENSRNOG00000048164 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ACAD8 pAb (ATL-HPA040689) | |
| Datasheet | Anti ACAD8 pAb (ATL-HPA040689) Datasheet (External Link) |
| Vendor Page | Anti ACAD8 pAb (ATL-HPA040689) at Atlas Antibodies |
| Documents & Links for Anti ACAD8 pAb (ATL-HPA040689) | |
| Datasheet | Anti ACAD8 pAb (ATL-HPA040689) Datasheet (External Link) |
| Vendor Page | Anti ACAD8 pAb (ATL-HPA040689) |
| Citations for Anti ACAD8 pAb (ATL-HPA040689) – 1 Found |
| Sinha, Ankit; Huang, Vincent; Livingstone, Julie; Wang, Jenny; Fox, Natalie S; Kurganovs, Natalie; Ignatchenko, Vladimir; Fritsch, Katharina; Donmez, Nilgun; Heisler, Lawrence E; Shiah, Yu-Jia; Yao, Cindy Q; Alfaro, Javier A; Volik, Stas; Lapuk, Anna; Fraser, Michael; Kron, Ken; Murison, Alex; Lupien, Mathieu; Sahinalp, Cenk; Collins, Colin C; Tetu, Bernard; Masoomian, Mehdi; Berman, David M; van der Kwast, Theodorus; Bristow, Robert G; Kislinger, Thomas; Boutros, Paul C. The Proteogenomic Landscape of Curable Prostate Cancer. Cancer Cell. 2019;35(3):414-427.e6. PubMed |


| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ELFPVDVMRKAAQLGFGGVYIQTDVGGSGLSRLDTSVIFEALATGCTSTTAYISIHNMCAWMIDSFGNEEQRHKFCPPL |
| Gene Sequence | ELFPVDVMRKAAQLGFGGVYIQTDVGGSGLSRLDTSVIFEALATGCTSTTAYISIHNMCAWMIDSFGNEEQRHKFCPPL |
| Gene ID - Mouse | ENSMUSG00000031969 |
| Gene ID - Rat | ENSRNOG00000048164 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ACAD8 pAb (ATL-HPA040689) | |
| Datasheet | Anti ACAD8 pAb (ATL-HPA040689) Datasheet (External Link) |
| Vendor Page | Anti ACAD8 pAb (ATL-HPA040689) at Atlas Antibodies |
| Documents & Links for Anti ACAD8 pAb (ATL-HPA040689) | |
| Datasheet | Anti ACAD8 pAb (ATL-HPA040689) Datasheet (External Link) |
| Vendor Page | Anti ACAD8 pAb (ATL-HPA040689) |
| Citations for Anti ACAD8 pAb (ATL-HPA040689) – 1 Found |
| Sinha, Ankit; Huang, Vincent; Livingstone, Julie; Wang, Jenny; Fox, Natalie S; Kurganovs, Natalie; Ignatchenko, Vladimir; Fritsch, Katharina; Donmez, Nilgun; Heisler, Lawrence E; Shiah, Yu-Jia; Yao, Cindy Q; Alfaro, Javier A; Volik, Stas; Lapuk, Anna; Fraser, Michael; Kron, Ken; Murison, Alex; Lupien, Mathieu; Sahinalp, Cenk; Collins, Colin C; Tetu, Bernard; Masoomian, Mehdi; Berman, David M; van der Kwast, Theodorus; Bristow, Robert G; Kislinger, Thomas; Boutros, Paul C. The Proteogenomic Landscape of Curable Prostate Cancer. Cancer Cell. 2019;35(3):414-427.e6. PubMed |
No reviews have been added for this product.