Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies


![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/45555/25827/atl-hpa022271_anti-acads-pab-atl-hpa022271-wenhanced-validation_36632__86416.1783628733.jpg?compression=lossy)


![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/45555/25827/atl-hpa022271_anti-acads-pab-atl-hpa022271-wenhanced-validation_36632__86416.1783628733.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ELPETHQMLLQTCRDFAEKELFPIAAQVDKEHLFPAAQVKKMGGLGLLAMDVPEELGGAGLDYLAYAIAMEEISRGCASTGVIMSVNNSLYLGPILKFGSKEQKQAWVTPFTSGDKIGCFALSEPGNGS |
| Gene Sequence | ELPETHQMLLQTCRDFAEKELFPIAAQVDKEHLFPAAQVKKMGGLGLLAMDVPEELGGAGLDYLAYAIAMEEISRGCASTGVIMSVNNSLYLGPILKFGSKEQKQAWVTPFTSGDKIGCFALSEPGNGS |
| Gene ID - Mouse | ENSMUSG00000029545 |
| Gene ID - Rat | ENSRNOG00000001177 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ACADS pAb (ATL-HPA022271 w/enhanced validation) | |
| Datasheet | Anti ACADS pAb (ATL-HPA022271 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ACADS pAb (ATL-HPA022271 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ACADS pAb (ATL-HPA022271 w/enhanced validation) | |
| Datasheet | Anti ACADS pAb (ATL-HPA022271 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ACADS pAb (ATL-HPA022271 w/enhanced validation) |
| Citations for Anti ACADS pAb (ATL-HPA022271 w/enhanced validation) – 1 Found |
| Ericksen, Russell E; Lim, Siew Lan; McDonnell, Eoin; Shuen, Wai Ho; Vadiveloo, Maya; White, Phillip J; Ding, Zhaobing; Kwok, Royston; Lee, Philip; Radda, George K; Toh, Han Chong; Hirschey, Matthew D; Han, Weiping. Loss of BCAA Catabolism during Carcinogenesis Enhances mTORC1 Activity and Promotes Tumor Development and Progression. Cell Metabolism. 2019;29(5):1151-1165.e6. PubMed |


![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/45555/25827/atl-hpa022271_anti-acads-pab-atl-hpa022271-wenhanced-validation_36632__86416.1783628733.jpg?compression=lossy)


![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/45555/25827/atl-hpa022271_anti-acads-pab-atl-hpa022271-wenhanced-validation_36632__86416.1783628733.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ELPETHQMLLQTCRDFAEKELFPIAAQVDKEHLFPAAQVKKMGGLGLLAMDVPEELGGAGLDYLAYAIAMEEISRGCASTGVIMSVNNSLYLGPILKFGSKEQKQAWVTPFTSGDKIGCFALSEPGNGS |
| Gene Sequence | ELPETHQMLLQTCRDFAEKELFPIAAQVDKEHLFPAAQVKKMGGLGLLAMDVPEELGGAGLDYLAYAIAMEEISRGCASTGVIMSVNNSLYLGPILKFGSKEQKQAWVTPFTSGDKIGCFALSEPGNGS |
| Gene ID - Mouse | ENSMUSG00000029545 |
| Gene ID - Rat | ENSRNOG00000001177 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ACADS pAb (ATL-HPA022271 w/enhanced validation) | |
| Datasheet | Anti ACADS pAb (ATL-HPA022271 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ACADS pAb (ATL-HPA022271 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ACADS pAb (ATL-HPA022271 w/enhanced validation) | |
| Datasheet | Anti ACADS pAb (ATL-HPA022271 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ACADS pAb (ATL-HPA022271 w/enhanced validation) |
| Citations for Anti ACADS pAb (ATL-HPA022271 w/enhanced validation) – 1 Found |
| Ericksen, Russell E; Lim, Siew Lan; McDonnell, Eoin; Shuen, Wai Ho; Vadiveloo, Maya; White, Phillip J; Ding, Zhaobing; Kwok, Royston; Lee, Philip; Radda, George K; Toh, Han Chong; Hirschey, Matthew D; Han, Weiping. Loss of BCAA Catabolism during Carcinogenesis Enhances mTORC1 Activity and Promotes Tumor Development and Progression. Cell Metabolism. 2019;29(5):1151-1165.e6. PubMed |