Related products

No related products found

Try browsing our complete catalog of products.

Reviews 0

No reviews have been added for this product.

Reviews

Protein Description: atypical chemokine receptor 3
Gene Name: ACKR3
Alternative Gene Name: CMKOR1, CXCR7, GPR159, RDC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044337: 84%, ENSRNOG00000019622: 84%
Entrez Gene ID: 57007
Uniprot ID: P25106
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application	IHC
Reactivity	Human
Clonality	Polyclonal
Host	Rabbit
Immunogen	LHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLY
Gene Sequence	LHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLY
Gene ID - Mouse	ENSMUSG00000044337
Gene ID - Rat	ENSRNOG00000019622
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ACKR3 pAb (ATL-HPA049718)
Datasheet	Anti ACKR3 pAb (ATL-HPA049718) Datasheet (External Link)
Vendor Page	Anti ACKR3 pAb (ATL-HPA049718) at Atlas Antibodies

Documents & Links for Anti ACKR3 pAb (ATL-HPA049718)
Datasheet	Anti ACKR3 pAb (ATL-HPA049718) Datasheet (External Link)
Vendor Page	Anti ACKR3 pAb (ATL-HPA049718)

Citations for Anti ACKR3 pAb (ATL-HPA049718) – 1 Found

Fan, Li-Ching; Jeng, Yung-Ming; Lu, Yueh-Tong; Lien, Huang-Chun. SPOCK1 Is a Novel Transforming Growth Factor-β-Induced Myoepithelial Marker That Enhances Invasion and Correlates with Poor Prognosis in Breast Cancer. Plos One. 11(9):e0162933. PubMed

No related products found

Reviews 0

Reviews

Anti ACKR3 pAb (ATL-HPA049718)

Additional information

Anti ACKR3 pAb (ATL-HPA049718)

Additional information

Specifications

No related products found

Reviews 0

Anti ACKR3 pAb (ATL-HPA049718)

Additional information

Specifications

Anti ACKR3 pAb (ATL-HPA049718)

Additional information

Specifications

Specifications