Related products

No related products found

Try browsing our complete catalog of products.

Reviews 0

No reviews have been added for this product.

Reviews

Protein Description: aconitase 1, soluble
Gene Name: ACO1
Alternative Gene Name: IREB1, IREBP, IRP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028405: 89%, ENSRNOG00000005849: 90%
Entrez Gene ID: 48
Uniprot ID: P21399
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application	WB, ICC, IHC
Reactivity	Human, Mouse, Rat
Clonality	Polyclonal
Host	Rabbit
Immunogen	YERIHRSNLVGMGVIPLEYLPGENADALGLTGQERYTIIIPENLKPQMKVQVKLDTGKTFQAVMRFDTDVELTYFLNGGILNYMIRKMAK
Gene Sequence	YERIHRSNLVGMGVIPLEYLPGENADALGLTGQERYTIIIPENLKPQMKVQVKLDTGKTFQAVMRFDTDVELTYFLNGGILNYMIRKMAK
Gene ID - Mouse	ENSMUSG00000028405
Gene ID - Rat	ENSRNOG00000005849
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ACO1 pAb (ATL-HPA019371 w/enhanced validation)
Datasheet	Anti ACO1 pAb (ATL-HPA019371 w/enhanced validation) Datasheet (External Link)
Vendor Page	Anti ACO1 pAb (ATL-HPA019371 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ACO1 pAb (ATL-HPA019371 w/enhanced validation)
Datasheet	Anti ACO1 pAb (ATL-HPA019371 w/enhanced validation) Datasheet (External Link)
Vendor Page	Anti ACO1 pAb (ATL-HPA019371 w/enhanced validation)

Citations for Anti ACO1 pAb (ATL-HPA019371 w/enhanced validation) – 2 Found

Haro, Kurtis J; Sheth, Aneesh; Scheinberg, David A. Dysregulation of IRP1-mediated iron metabolism causes gamma ray-specific radioresistance in leukemia cells. Plos One. 7(11):e48841. PubMed

Kung, Woon-Man; Lin, Chai-Ching; Chen, Wei-Jung; Jiang, Li-Lin; Sun, Yu-Yo; Hsieh, Kuang-Hui; Lin, Muh-Shi. Anti-Inflammatory CDGSH Iron-Sulfur Domain 2: A Biomarker of Central Nervous System Insult in Cellular, Animal Models and Patients. Biomedicines. 2022;10(4) PubMed

No related products found

Reviews 0

Reviews

Anti ACO1 pAb (ATL-HPA019371 w/enhanced validation)

Additional information

Specifications

Reviews 0

Anti ACO1 pAb (ATL-HPA019371 w/enhanced validation)

Additional information

Specifications

No related products found

Anti ACO1 pAb (ATL-HPA019371 w/enhanced validation)

Additional information

Anti ACO1 pAb (ATL-HPA019371 w/enhanced validation)

Additional information

Specifications

Specifications