Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies






| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VHIVNKADIAMVICDTPQKALVLIGNVEKGFTPSLKVIILMDPFDDDLKQRGEKSGIEILSLYDAENLGKEHFRKPVPPSPEDLSVICFTSGTTGDPK |
| Gene Sequence | VHIVNKADIAMVICDTPQKALVLIGNVEKGFTPSLKVIILMDPFDDDLKQRGEKSGIEILSLYDAENLGKEHFRKPVPPSPEDLSVICFTSGTTGDPK |
| Gene ID - Mouse | ENSMUSG00000024981 |
| Gene ID - Rat | ENSRNOG00000016265 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ACSL5 pAb (ATL-HPA007162 w/enhanced validation) | |
| Datasheet | Anti ACSL5 pAb (ATL-HPA007162 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ACSL5 pAb (ATL-HPA007162 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ACSL5 pAb (ATL-HPA007162 w/enhanced validation) | |
| Datasheet | Anti ACSL5 pAb (ATL-HPA007162 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ACSL5 pAb (ATL-HPA007162 w/enhanced validation) |
| Citations for Anti ACSL5 pAb (ATL-HPA007162 w/enhanced validation) – 1 Found |
| Menon, Deepak; Salloum, Darin; Bernfeld, Elyssa; Gorodetsky, Elizabeth; Akselrod, Alla; Frias, Maria A; Sudderth, Jessica; Chen, Pei-Hsuan; DeBerardinis, Ralph; Foster, David A. Lipid sensing by mTOR complexes via de novo synthesis of phosphatidic acid. The Journal Of Biological Chemistry. 2017;292(15):6303-6311. PubMed |






| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VHIVNKADIAMVICDTPQKALVLIGNVEKGFTPSLKVIILMDPFDDDLKQRGEKSGIEILSLYDAENLGKEHFRKPVPPSPEDLSVICFTSGTTGDPK |
| Gene Sequence | VHIVNKADIAMVICDTPQKALVLIGNVEKGFTPSLKVIILMDPFDDDLKQRGEKSGIEILSLYDAENLGKEHFRKPVPPSPEDLSVICFTSGTTGDPK |
| Gene ID - Mouse | ENSMUSG00000024981 |
| Gene ID - Rat | ENSRNOG00000016265 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ACSL5 pAb (ATL-HPA007162 w/enhanced validation) | |
| Datasheet | Anti ACSL5 pAb (ATL-HPA007162 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ACSL5 pAb (ATL-HPA007162 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ACSL5 pAb (ATL-HPA007162 w/enhanced validation) | |
| Datasheet | Anti ACSL5 pAb (ATL-HPA007162 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ACSL5 pAb (ATL-HPA007162 w/enhanced validation) |
| Citations for Anti ACSL5 pAb (ATL-HPA007162 w/enhanced validation) – 1 Found |
| Menon, Deepak; Salloum, Darin; Bernfeld, Elyssa; Gorodetsky, Elizabeth; Akselrod, Alla; Frias, Maria A; Sudderth, Jessica; Chen, Pei-Hsuan; DeBerardinis, Ralph; Foster, David A. Lipid sensing by mTOR complexes via de novo synthesis of phosphatidic acid. The Journal Of Biological Chemistry. 2017;292(15):6303-6311. PubMed |