Loading...
Loading...
Loading...
Loading...
No reviews have been added for this product.
Atlas Antibodies




| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MATRNSPMPLGTAQGDPGEAGTRPGPDASLRDTGAATQLKMKPRKVHKIKAVIIDLGSQYCKCGYAGEPRPTYFISSTVGKRCPEAADAGDTRKWTL |
| Gene Sequence | MATRNSPMPLGTAQGDPGEAGTRPGPDASLRDTGAATQLKMKPRKVHKIKAVIIDLGSQYCKCGYAGEPRPTYFISSTVGKRCPEAADAGDTRKWTL |
| Gene ID - Mouse | ENSMUSG00000070980 |
| Gene ID - Rat | ENSRNOG00000016621 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ACTL7B pAb (ATL-HPA021803 w/enhanced validation) | |
| Datasheet | Anti ACTL7B pAb (ATL-HPA021803 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ACTL7B pAb (ATL-HPA021803 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ACTL7B pAb (ATL-HPA021803 w/enhanced validation) | |
| Datasheet | Anti ACTL7B pAb (ATL-HPA021803 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ACTL7B pAb (ATL-HPA021803 w/enhanced validation) |
| Citations for Anti ACTL7B pAb (ATL-HPA021803 w/enhanced validation) – 3 Found |
| Andersson, Sandra; Konrad, Anna; Ashok, Nikhil; Pontén, Fredrik; Hober, Sophia; Asplund, Anna. Antibodies biotinylated using a synthetic Z-domain from protein A provide stringent in situ protein detection. The Journal Of Histochemistry And Cytochemistry : Official Journal Of The Histochemistry Society. 2013;61(11):773-84. PubMed |
| Djureinovic, D; Fagerberg, L; Hallström, B; Danielsson, A; Lindskog, C; Uhlén, M; Pontén, F. The human testis-specific proteome defined by transcriptomics and antibody-based profiling. Molecular Human Reproduction. 2014;20(6):476-88. PubMed |
| Cadalbert, Laurence C; Ghaffar, Farah Naz; Stevenson, David; Bryson, Sheila; Vaz, Frédéric M; Gottlieb, Eyal; Strathdee, Douglas. Mouse Tafazzin Is Required for Male Germ Cell Meiosis and Spermatogenesis. Plos One. 10(6):e0131066. PubMed |
Try browsing our complete catalog of products.
Atlas Antibodies




| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MATRNSPMPLGTAQGDPGEAGTRPGPDASLRDTGAATQLKMKPRKVHKIKAVIIDLGSQYCKCGYAGEPRPTYFISSTVGKRCPEAADAGDTRKWTL |
| Gene Sequence | MATRNSPMPLGTAQGDPGEAGTRPGPDASLRDTGAATQLKMKPRKVHKIKAVIIDLGSQYCKCGYAGEPRPTYFISSTVGKRCPEAADAGDTRKWTL |
| Gene ID - Mouse | ENSMUSG00000070980 |
| Gene ID - Rat | ENSRNOG00000016621 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ACTL7B pAb (ATL-HPA021803 w/enhanced validation) | |
| Datasheet | Anti ACTL7B pAb (ATL-HPA021803 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ACTL7B pAb (ATL-HPA021803 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ACTL7B pAb (ATL-HPA021803 w/enhanced validation) | |
| Datasheet | Anti ACTL7B pAb (ATL-HPA021803 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ACTL7B pAb (ATL-HPA021803 w/enhanced validation) |
| Citations for Anti ACTL7B pAb (ATL-HPA021803 w/enhanced validation) – 3 Found |
| Andersson, Sandra; Konrad, Anna; Ashok, Nikhil; Pontén, Fredrik; Hober, Sophia; Asplund, Anna. Antibodies biotinylated using a synthetic Z-domain from protein A provide stringent in situ protein detection. The Journal Of Histochemistry And Cytochemistry : Official Journal Of The Histochemistry Society. 2013;61(11):773-84. PubMed |
| Djureinovic, D; Fagerberg, L; Hallström, B; Danielsson, A; Lindskog, C; Uhlén, M; Pontén, F. The human testis-specific proteome defined by transcriptomics and antibody-based profiling. Molecular Human Reproduction. 2014;20(6):476-88. PubMed |
| Cadalbert, Laurence C; Ghaffar, Farah Naz; Stevenson, David; Bryson, Sheila; Vaz, Frédéric M; Gottlieb, Eyal; Strathdee, Douglas. Mouse Tafazzin Is Required for Male Germ Cell Meiosis and Spermatogenesis. Plos One. 10(6):e0131066. PubMed |