Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQL |
| Gene Sequence | DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQL |
| Gene ID - Mouse | ENSMUSG00000000530 |
| Gene ID - Rat | ENSRNOG00000028713 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ACVRL1 pAb (ATL-HPA007041) | |
| Datasheet | Anti ACVRL1 pAb (ATL-HPA007041) Datasheet (External Link) |
| Vendor Page | Anti ACVRL1 pAb (ATL-HPA007041) at Atlas Antibodies |
| Documents & Links for Anti ACVRL1 pAb (ATL-HPA007041) | |
| Datasheet | Anti ACVRL1 pAb (ATL-HPA007041) Datasheet (External Link) |
| Vendor Page | Anti ACVRL1 pAb (ATL-HPA007041) |
| Citations for Anti ACVRL1 pAb (ATL-HPA007041) – 4 Found |
| Adams, Stephanie L; Benayoun, Laurent; Tilton, Kathy; Mellott, Tiffany J; Seshadri, Sudha; Blusztajn, Jan Krzysztof; Delalle, Ivana. Immunohistochemical Analysis of Activin Receptor-Like Kinase 1 (ACVRL1/ALK1) Expression in the Rat and Human Hippocampus: Decline in CA3 During Progression of Alzheimer's Disease. Journal Of Alzheimer's Disease : Jad. 63(4):1433-1443. PubMed |
| Cunha, Sara I; Pardali, Evangelia; Thorikay, Midory; Anderberg, Charlotte; Hawinkels, Lukas; Goumans, Marie-José; Seehra, Jasbir; Heldin, Carl-Henrik; ten Dijke, Peter; Pietras, Kristian. Genetic and pharmacological targeting of activin receptor-like kinase 1 impairs tumor growth and angiogenesis. The Journal Of Experimental Medicine. 2010;207(1):85-100. PubMed |
| Toyonaga, Takahiko; Steinbach, Erin C; Keith, Benjamin P; Barrow, Jasmine B; Schaner, Matthew R; Wolber, Elisabeth A; Beasley, Caroline; Huling, Jennifer; Wang, Yuli; Allbritton, Nancy L; Chaumont, Nicole; Sadiq, Timothy S; Koruda, Mark J; Jain, Animesh; Long, Millie D; Barnes, Edward L; Herfarth, Hans H; Isaacs, Kim L; Hansen, Jonathan J; Shanahan, Michael T; Rahbar, Reza; Furey, Terrence S; Sethupathy, Praveen; Sheikh, Shehzad Z. Decreased Colonic Activin Receptor-Like Kinase 1 Disrupts Epithelial Barrier Integrity in Patients With Crohn's Disease. Cellular And Molecular Gastroenterology And Hepatology. 10(4):779-796. PubMed |
| Anderson, Kelley E; Bellio, Thomas A; Aniskovich, Emily; Adams, Stephanie L; Blusztajn, Jan Krzysztof; Delalle, Ivana. The Expression of Activin Receptor-Like Kinase 1 (ACVRL1/ALK1) in Hippocampal Arterioles Declines During Progression of Alzheimer's Disease. Cerebral Cortex Communications. 1(1):tgaa031. PubMed |
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQL |
| Gene Sequence | DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQL |
| Gene ID - Mouse | ENSMUSG00000000530 |
| Gene ID - Rat | ENSRNOG00000028713 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ACVRL1 pAb (ATL-HPA007041) | |
| Datasheet | Anti ACVRL1 pAb (ATL-HPA007041) Datasheet (External Link) |
| Vendor Page | Anti ACVRL1 pAb (ATL-HPA007041) at Atlas Antibodies |
| Documents & Links for Anti ACVRL1 pAb (ATL-HPA007041) | |
| Datasheet | Anti ACVRL1 pAb (ATL-HPA007041) Datasheet (External Link) |
| Vendor Page | Anti ACVRL1 pAb (ATL-HPA007041) |
| Citations for Anti ACVRL1 pAb (ATL-HPA007041) – 4 Found |
| Adams, Stephanie L; Benayoun, Laurent; Tilton, Kathy; Mellott, Tiffany J; Seshadri, Sudha; Blusztajn, Jan Krzysztof; Delalle, Ivana. Immunohistochemical Analysis of Activin Receptor-Like Kinase 1 (ACVRL1/ALK1) Expression in the Rat and Human Hippocampus: Decline in CA3 During Progression of Alzheimer's Disease. Journal Of Alzheimer's Disease : Jad. 63(4):1433-1443. PubMed |
| Cunha, Sara I; Pardali, Evangelia; Thorikay, Midory; Anderberg, Charlotte; Hawinkels, Lukas; Goumans, Marie-José; Seehra, Jasbir; Heldin, Carl-Henrik; ten Dijke, Peter; Pietras, Kristian. Genetic and pharmacological targeting of activin receptor-like kinase 1 impairs tumor growth and angiogenesis. The Journal Of Experimental Medicine. 2010;207(1):85-100. PubMed |
| Toyonaga, Takahiko; Steinbach, Erin C; Keith, Benjamin P; Barrow, Jasmine B; Schaner, Matthew R; Wolber, Elisabeth A; Beasley, Caroline; Huling, Jennifer; Wang, Yuli; Allbritton, Nancy L; Chaumont, Nicole; Sadiq, Timothy S; Koruda, Mark J; Jain, Animesh; Long, Millie D; Barnes, Edward L; Herfarth, Hans H; Isaacs, Kim L; Hansen, Jonathan J; Shanahan, Michael T; Rahbar, Reza; Furey, Terrence S; Sethupathy, Praveen; Sheikh, Shehzad Z. Decreased Colonic Activin Receptor-Like Kinase 1 Disrupts Epithelial Barrier Integrity in Patients With Crohn's Disease. Cellular And Molecular Gastroenterology And Hepatology. 10(4):779-796. PubMed |
| Anderson, Kelley E; Bellio, Thomas A; Aniskovich, Emily; Adams, Stephanie L; Blusztajn, Jan Krzysztof; Delalle, Ivana. The Expression of Activin Receptor-Like Kinase 1 (ACVRL1/ALK1) in Hippocampal Arterioles Declines During Progression of Alzheimer's Disease. Cerebral Cortex Communications. 1(1):tgaa031. PubMed |