Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LLFTNKKTTIEKLRCVRPSRPPRGFQPCQAHLGHLGKGLMRKPPDSYPPKDNPRRLLQCQNVDISRPLN |
| Gene Sequence | LLFTNKKTTIEKLRCVRPSRPPRGFQPCQAHLGHLGKGLMRKPPDSYPPKDNPRRLLQCQNVDISRPLN |
| Gene ID - Mouse | ENSMUSG00000054555 |
| Gene ID - Rat | ENSRNOG00000018384 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ADAM12 pAb (ATL-HPA030867 w/enhanced validation) | |
| Datasheet | Anti ADAM12 pAb (ATL-HPA030867 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ADAM12 pAb (ATL-HPA030867 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ADAM12 pAb (ATL-HPA030867 w/enhanced validation) | |
| Datasheet | Anti ADAM12 pAb (ATL-HPA030867 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ADAM12 pAb (ATL-HPA030867 w/enhanced validation) |
| Citations for Anti ADAM12 pAb (ATL-HPA030867 w/enhanced validation) – 2 Found |
| Qundos, Ulrika; Hong, Mun-Gwan; Tybring, Gunnel; Divers, Mark; Odeberg, Jacob; Uhlen, Mathias; Nilsson, Peter; Schwenk, Jochen M. Profiling post-centrifugation delay of serum and plasma with antibody bead arrays. Journal Of Proteomics. 2013;95( 23631827):46-54. PubMed |
| Naciri, Ikrame; Laisné, Marthe; Ferry, Laure; Bourmaud, Morgane; Gupta, Nikhil; Di Carlo, Selene; Huna, Anda; Martin, Nadine; Peduto, Lucie; Bernard, David; Kirsh, Olivier; Defossez, Pierre-Antoine. Genetic screens reveal mechanisms for the transcriptional regulation of tissue-specific genes in normal cells and tumors. Nucleic Acids Research. 2019;47(7):3407-3421. PubMed |
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LLFTNKKTTIEKLRCVRPSRPPRGFQPCQAHLGHLGKGLMRKPPDSYPPKDNPRRLLQCQNVDISRPLN |
| Gene Sequence | LLFTNKKTTIEKLRCVRPSRPPRGFQPCQAHLGHLGKGLMRKPPDSYPPKDNPRRLLQCQNVDISRPLN |
| Gene ID - Mouse | ENSMUSG00000054555 |
| Gene ID - Rat | ENSRNOG00000018384 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ADAM12 pAb (ATL-HPA030867 w/enhanced validation) | |
| Datasheet | Anti ADAM12 pAb (ATL-HPA030867 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ADAM12 pAb (ATL-HPA030867 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ADAM12 pAb (ATL-HPA030867 w/enhanced validation) | |
| Datasheet | Anti ADAM12 pAb (ATL-HPA030867 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ADAM12 pAb (ATL-HPA030867 w/enhanced validation) |
| Citations for Anti ADAM12 pAb (ATL-HPA030867 w/enhanced validation) – 2 Found |
| Qundos, Ulrika; Hong, Mun-Gwan; Tybring, Gunnel; Divers, Mark; Odeberg, Jacob; Uhlen, Mathias; Nilsson, Peter; Schwenk, Jochen M. Profiling post-centrifugation delay of serum and plasma with antibody bead arrays. Journal Of Proteomics. 2013;95( 23631827):46-54. PubMed |
| Naciri, Ikrame; Laisné, Marthe; Ferry, Laure; Bourmaud, Morgane; Gupta, Nikhil; Di Carlo, Selene; Huna, Anda; Martin, Nadine; Peduto, Lucie; Bernard, David; Kirsh, Olivier; Defossez, Pierre-Antoine. Genetic screens reveal mechanisms for the transcriptional regulation of tissue-specific genes in normal cells and tumors. Nucleic Acids Research. 2019;47(7):3407-3421. PubMed |