Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/53070/39465/atl-hpa044050_anti-adamtsl5-pab-atl-hpa044050_50667__87903.1783638406.jpg?compression=lossy)
| Product Specifications | |
| Application | WB |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AHRLLHYCGSDFVFQARVLGHHHQAQETRYEVRIQLVYKNRSPLRAREYVWAPGHCPCPMLAPHRDYLMAVQRLVSPDGTQDQ |
| Gene Sequence | AHRLLHYCGSDFVFQARVLGHHHQAQETRYEVRIQLVYKNRSPLRAREYVWAPGHCPCPMLAPHRDYLMAVQRLVSPDGTQDQ |
| Gene ID - Mouse | ENSMUSG00000043822 |
| Gene ID - Rat | ENSRNOG00000008634 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ADAMTSL5 pAb (ATL-HPA044050) | |
| Datasheet | Anti ADAMTSL5 pAb (ATL-HPA044050) Datasheet (External Link) |
| Vendor Page | Anti ADAMTSL5 pAb (ATL-HPA044050) at Atlas Antibodies |
| Documents & Links for Anti ADAMTSL5 pAb (ATL-HPA044050) | |
| Datasheet | Anti ADAMTSL5 pAb (ATL-HPA044050) Datasheet (External Link) |
| Vendor Page | Anti ADAMTSL5 pAb (ATL-HPA044050) |
| Citations for Anti ADAMTSL5 pAb (ATL-HPA044050) – 1 Found |
| Pouw, Juliëtte N; Olde Nordkamp, Michel A M; van Kempen, Tessa; Concepcion, Arno N; van Laar, Jacob M; van Wijk, Femke; Spierings, Julia; Leijten, Emmerik F A; Boes, Marianne. Regulatory T cells in psoriatic arthritis: an IL-17A-producing, Foxp3(int)CD161 + RORγt + ICOS + phenotype, that associates with the presence of ADAMTSL5 autoantibodies. Scientific Reports. 2022;12(1):20675. PubMed |
| Product Specifications | |
| Application | WB |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AHRLLHYCGSDFVFQARVLGHHHQAQETRYEVRIQLVYKNRSPLRAREYVWAPGHCPCPMLAPHRDYLMAVQRLVSPDGTQDQ |
| Gene Sequence | AHRLLHYCGSDFVFQARVLGHHHQAQETRYEVRIQLVYKNRSPLRAREYVWAPGHCPCPMLAPHRDYLMAVQRLVSPDGTQDQ |
| Gene ID - Mouse | ENSMUSG00000043822 |
| Gene ID - Rat | ENSRNOG00000008634 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ADAMTSL5 pAb (ATL-HPA044050) | |
| Datasheet | Anti ADAMTSL5 pAb (ATL-HPA044050) Datasheet (External Link) |
| Vendor Page | Anti ADAMTSL5 pAb (ATL-HPA044050) at Atlas Antibodies |
| Documents & Links for Anti ADAMTSL5 pAb (ATL-HPA044050) | |
| Datasheet | Anti ADAMTSL5 pAb (ATL-HPA044050) Datasheet (External Link) |
| Vendor Page | Anti ADAMTSL5 pAb (ATL-HPA044050) |
| Citations for Anti ADAMTSL5 pAb (ATL-HPA044050) – 1 Found |
| Pouw, Juliëtte N; Olde Nordkamp, Michel A M; van Kempen, Tessa; Concepcion, Arno N; van Laar, Jacob M; van Wijk, Femke; Spierings, Julia; Leijten, Emmerik F A; Boes, Marianne. Regulatory T cells in psoriatic arthritis: an IL-17A-producing, Foxp3(int)CD161 + RORγt + ICOS + phenotype, that associates with the presence of ADAMTSL5 autoantibodies. Scientific Reports. 2022;12(1):20675. PubMed |