Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies


| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SVNTDFTSDQADFPDTLFNGFETPDKAEPPFYVGSNGDDSFSSSGDLSLSASPVPASLAQPPLPVLPPFPPPSGKNPVMILNELRPGLKYDFLSESGESHAKSFVMSVVV |
| Gene Sequence | SVNTDFTSDQADFPDTLFNGFETPDKAEPPFYVGSNGDDSFSSSGDLSLSASPVPASLAQPPLPVLPPFPPPSGKNPVMILNELRPGLKYDFLSESGESHAKSFVMSVVV |
| Gene ID - Mouse | ENSMUSG00000020262 |
| Gene ID - Rat | ENSRNOG00000001227 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ADARB1 pAb (ATL-HPA018277) | |
| Datasheet | Anti ADARB1 pAb (ATL-HPA018277) Datasheet (External Link) |
| Vendor Page | Anti ADARB1 pAb (ATL-HPA018277) at Atlas Antibodies |
| Documents & Links for Anti ADARB1 pAb (ATL-HPA018277) | |
| Datasheet | Anti ADARB1 pAb (ATL-HPA018277) Datasheet (External Link) |
| Vendor Page | Anti ADARB1 pAb (ATL-HPA018277) |
| Citations for Anti ADARB1 pAb (ATL-HPA018277) – 8 Found |
| Anantharaman, Aparna; Tripathi, Vidisha; Khan, Abid; Yoon, Je-Hyun; Singh, Deepak K; Gholamalamdari, Omid; Guang, Shuomeng; Ohlson, Johan; Wahlstedt, Helene; Öhman, Marie; Jantsch, Michael F; Conrad, Nicholas K; Ma, Jian; Gorospe, Myriam; Prasanth, Supriya G; Prasanth, Kannanganattu V. ADAR2 regulates RNA stability by modifying access of decay-promoting RNA-binding proteins. Nucleic Acids Research. 2017;45(7):4189-4201. PubMed |
| Fritzell, Kajsa; Xu, Li-Di; Otrocka, Magdalena; Andréasson, Claes; Öhman, Marie. Sensitive ADAR editing reporter in cancer cells enables high-throughput screening of small molecule libraries. Nucleic Acids Research. 2019;47(4):e22. PubMed |
| Siqueira, Edilene; Obiols-Guardia, Aida; Jorge-Torres, Olga C; Oliveira-Mateos, Cristina; Soler, Marta; Ramesh-Kumar, Deepthi; Setién, Fernando; van Rossum, Daniëlle; Pascual-Alonso, Ainhoa; Xiol, Clara; Ivan, Cristina; Shimizu, Masayoshi; Armstrong, Judith; Calin, George A; Pasterkamp, R Jeroen; Esteller, Manel; Guil, Sonia. Analysis of the circRNA and T-UCR populations identifies convergent pathways in mouse and human models of Rett syndrome. Molecular Therapy. Nucleic Acids. 2022;27( 35036070):621-644. PubMed |
| Widmark, Albin; Sagredo, Eduardo A; Karlström, Victor; Behm, Mikaela; Biryukova, Inna; Friedländer, Marc R; Daniel, Chammiran; Öhman, Marie. ADAR1- and ADAR2-mediated regulation of maturation and targeting of miR-376b to modulate GABA neurotransmitter catabolism. The Journal Of Biological Chemistry. 2022;298(3):101682. PubMed |
| Witman, Nevin M; Behm, Mikaela; Ohman, Marie; Morrison, Jamie I. ADAR-related activation of adenosine-to-inosine RNA editing during regeneration. Stem Cells And Development. 2013;22(16):2254-67. PubMed |
| Deng, Patricia; Khan, Anzer; Jacobson, Dionna; Sambrani, Nagraj; McGurk, Leeanne; Li, Xianghua; Jayasree, Aswathy; Hejatko, Jan; Shohat-Ophir, Galit; O'Connell, Mary A; Li, Jin Billy; Keegan, Liam P. Adar RNA editing-dependent and -independent effects are required for brain and innate immune functions in Drosophila. Nature Communications. 2020;11(1):1580. PubMed |
| Soler, Marta; Davalos, Veronica; Sánchez-Castillo, Anaís; Mora-Martinez, Carlos; Setién, Fernando; Siqueira, Edilene; Castro de Moura, Manuel; Esteller, Manel; Guil, Sonia. The transcribed ultraconserved region uc.160+ enhances processing and A-to-I editing of the miR-376 cluster: hypermethylation improves glioma prognosis. Molecular Oncology. 2022;16(3):648-664. PubMed |
| Hariharan, Ananya; Qi, Weihong; Rehrauer, Hubert; Wu, Licun; Ronner, Manuel; Wipplinger, Martin; Kresoja-Rakic, Jelena; Sun, Suna; Oton-Gonzalez, Lucia; Sculco, Marika; Serre-Beinier, Véronique; Meiller, Clément; Blanquart, Christophe; Fonteneau, Jean-François; Vrugt, Bart; Rüschoff, Jan Hendrik; Opitz, Isabelle; Jean, Didier; de Perrot, Marc; Felley-Bosco, Emanuela. Heterogeneous RNA editing and influence of ADAR2 on mesothelioma chemoresistance and the tumor microenvironment. Molecular Oncology. 2022;16(22):3949-3974. PubMed |


| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SVNTDFTSDQADFPDTLFNGFETPDKAEPPFYVGSNGDDSFSSSGDLSLSASPVPASLAQPPLPVLPPFPPPSGKNPVMILNELRPGLKYDFLSESGESHAKSFVMSVVV |
| Gene Sequence | SVNTDFTSDQADFPDTLFNGFETPDKAEPPFYVGSNGDDSFSSSGDLSLSASPVPASLAQPPLPVLPPFPPPSGKNPVMILNELRPGLKYDFLSESGESHAKSFVMSVVV |
| Gene ID - Mouse | ENSMUSG00000020262 |
| Gene ID - Rat | ENSRNOG00000001227 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ADARB1 pAb (ATL-HPA018277) | |
| Datasheet | Anti ADARB1 pAb (ATL-HPA018277) Datasheet (External Link) |
| Vendor Page | Anti ADARB1 pAb (ATL-HPA018277) at Atlas Antibodies |
| Documents & Links for Anti ADARB1 pAb (ATL-HPA018277) | |
| Datasheet | Anti ADARB1 pAb (ATL-HPA018277) Datasheet (External Link) |
| Vendor Page | Anti ADARB1 pAb (ATL-HPA018277) |
| Citations for Anti ADARB1 pAb (ATL-HPA018277) – 8 Found |
| Anantharaman, Aparna; Tripathi, Vidisha; Khan, Abid; Yoon, Je-Hyun; Singh, Deepak K; Gholamalamdari, Omid; Guang, Shuomeng; Ohlson, Johan; Wahlstedt, Helene; Öhman, Marie; Jantsch, Michael F; Conrad, Nicholas K; Ma, Jian; Gorospe, Myriam; Prasanth, Supriya G; Prasanth, Kannanganattu V. ADAR2 regulates RNA stability by modifying access of decay-promoting RNA-binding proteins. Nucleic Acids Research. 2017;45(7):4189-4201. PubMed |
| Fritzell, Kajsa; Xu, Li-Di; Otrocka, Magdalena; Andréasson, Claes; Öhman, Marie. Sensitive ADAR editing reporter in cancer cells enables high-throughput screening of small molecule libraries. Nucleic Acids Research. 2019;47(4):e22. PubMed |
| Siqueira, Edilene; Obiols-Guardia, Aida; Jorge-Torres, Olga C; Oliveira-Mateos, Cristina; Soler, Marta; Ramesh-Kumar, Deepthi; Setién, Fernando; van Rossum, Daniëlle; Pascual-Alonso, Ainhoa; Xiol, Clara; Ivan, Cristina; Shimizu, Masayoshi; Armstrong, Judith; Calin, George A; Pasterkamp, R Jeroen; Esteller, Manel; Guil, Sonia. Analysis of the circRNA and T-UCR populations identifies convergent pathways in mouse and human models of Rett syndrome. Molecular Therapy. Nucleic Acids. 2022;27( 35036070):621-644. PubMed |
| Widmark, Albin; Sagredo, Eduardo A; Karlström, Victor; Behm, Mikaela; Biryukova, Inna; Friedländer, Marc R; Daniel, Chammiran; Öhman, Marie. ADAR1- and ADAR2-mediated regulation of maturation and targeting of miR-376b to modulate GABA neurotransmitter catabolism. The Journal Of Biological Chemistry. 2022;298(3):101682. PubMed |
| Witman, Nevin M; Behm, Mikaela; Ohman, Marie; Morrison, Jamie I. ADAR-related activation of adenosine-to-inosine RNA editing during regeneration. Stem Cells And Development. 2013;22(16):2254-67. PubMed |
| Deng, Patricia; Khan, Anzer; Jacobson, Dionna; Sambrani, Nagraj; McGurk, Leeanne; Li, Xianghua; Jayasree, Aswathy; Hejatko, Jan; Shohat-Ophir, Galit; O'Connell, Mary A; Li, Jin Billy; Keegan, Liam P. Adar RNA editing-dependent and -independent effects are required for brain and innate immune functions in Drosophila. Nature Communications. 2020;11(1):1580. PubMed |
| Soler, Marta; Davalos, Veronica; Sánchez-Castillo, Anaís; Mora-Martinez, Carlos; Setién, Fernando; Siqueira, Edilene; Castro de Moura, Manuel; Esteller, Manel; Guil, Sonia. The transcribed ultraconserved region uc.160+ enhances processing and A-to-I editing of the miR-376 cluster: hypermethylation improves glioma prognosis. Molecular Oncology. 2022;16(3):648-664. PubMed |
| Hariharan, Ananya; Qi, Weihong; Rehrauer, Hubert; Wu, Licun; Ronner, Manuel; Wipplinger, Martin; Kresoja-Rakic, Jelena; Sun, Suna; Oton-Gonzalez, Lucia; Sculco, Marika; Serre-Beinier, Véronique; Meiller, Clément; Blanquart, Christophe; Fonteneau, Jean-François; Vrugt, Bart; Rüschoff, Jan Hendrik; Opitz, Isabelle; Jean, Didier; de Perrot, Marc; Felley-Bosco, Emanuela. Heterogeneous RNA editing and influence of ADAR2 on mesothelioma chemoresistance and the tumor microenvironment. Molecular Oncology. 2022;16(22):3949-3974. PubMed |