Loading...
Loading...
Loading...
Loading...
No reviews have been added for this product.
Atlas Antibodies

![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/55451/43279/atl-hpa051012_anti-adck1-pab-atl-hpa051012_54655__91845.1783640989.jpg?compression=lossy)

![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/55451/43279/atl-hpa051012_anti-adck1-pab-atl-hpa051012_54655__91845.1783640989.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YDYLTSLKSVPYGSEEYLQLRSKVHLRSARRLCELCCANRGTFIKVGQHLGALDYLLPEEYTSTLKVLHSQAPQSSMQEIRQVIRGDLGKE |
| Gene Sequence | YDYLTSLKSVPYGSEEYLQLRSKVHLRSARRLCELCCANRGTFIKVGQHLGALDYLLPEEYTSTLKVLHSQAPQSSMQEIRQVIRGDLGKE |
| Gene ID - Mouse | ENSMUSG00000021044 |
| Gene ID - Rat | ENSRNOG00000030334 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ADCK1 pAb (ATL-HPA051012) | |
| Datasheet | Anti ADCK1 pAb (ATL-HPA051012) Datasheet (External Link) |
| Vendor Page | Anti ADCK1 pAb (ATL-HPA051012) at Atlas Antibodies |
| Documents & Links for Anti ADCK1 pAb (ATL-HPA051012) | |
| Datasheet | Anti ADCK1 pAb (ATL-HPA051012) Datasheet (External Link) |
| Vendor Page | Anti ADCK1 pAb (ATL-HPA051012) |
| Citations for Anti ADCK1 pAb (ATL-HPA051012) – 1 Found |
| Ji, Yong; Liu, Yiqian; Sun, Changchun; Yu, Lijiang; Wang, Zhao; Du, Xu; Yang, Wu; Zhang, Chenggong; Tao, Chunmu; Wang, Jianjiang; Yang, Xi; Di, Sun; Huang, Yufeng. ADCK1 activates the β-catenin/TCF signaling pathway to promote the growth and migration of colon cancer cells. Cell Death & Disease. 2021;12(4):354. PubMed |
Try browsing our complete catalog of products.
Atlas Antibodies

![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/55451/43279/atl-hpa051012_anti-adck1-pab-atl-hpa051012_54655__91845.1783640989.jpg?compression=lossy)

![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/55451/43279/atl-hpa051012_anti-adck1-pab-atl-hpa051012_54655__91845.1783640989.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YDYLTSLKSVPYGSEEYLQLRSKVHLRSARRLCELCCANRGTFIKVGQHLGALDYLLPEEYTSTLKVLHSQAPQSSMQEIRQVIRGDLGKE |
| Gene Sequence | YDYLTSLKSVPYGSEEYLQLRSKVHLRSARRLCELCCANRGTFIKVGQHLGALDYLLPEEYTSTLKVLHSQAPQSSMQEIRQVIRGDLGKE |
| Gene ID - Mouse | ENSMUSG00000021044 |
| Gene ID - Rat | ENSRNOG00000030334 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ADCK1 pAb (ATL-HPA051012) | |
| Datasheet | Anti ADCK1 pAb (ATL-HPA051012) Datasheet (External Link) |
| Vendor Page | Anti ADCK1 pAb (ATL-HPA051012) at Atlas Antibodies |
| Documents & Links for Anti ADCK1 pAb (ATL-HPA051012) | |
| Datasheet | Anti ADCK1 pAb (ATL-HPA051012) Datasheet (External Link) |
| Vendor Page | Anti ADCK1 pAb (ATL-HPA051012) |
| Citations for Anti ADCK1 pAb (ATL-HPA051012) – 1 Found |
| Ji, Yong; Liu, Yiqian; Sun, Changchun; Yu, Lijiang; Wang, Zhao; Du, Xu; Yang, Wu; Zhang, Chenggong; Tao, Chunmu; Wang, Jianjiang; Yang, Xi; Di, Sun; Huang, Yufeng. ADCK1 activates the β-catenin/TCF signaling pathway to promote the growth and migration of colon cancer cells. Cell Death & Disease. 2021;12(4):354. PubMed |