Loading...
Loading...
Loading...
Loading...
Atlas Antibodies
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SEHFLKQLLGHMEDLEGDAQSVLDARELGMEERPYSSRLKKIGELLDQASVTREEVVSELGNGIAAFESVPTAIYCFLR |
| Gene Sequence | SEHFLKQLLGHMEDLEGDAQSVLDARELGMEERPYSSRLKKIGELLDQASVTREEVVSELGNGIAAFESVPTAIYCFLR |
| Gene ID - Mouse | ENSMUSG00000042558 |
| Gene ID - Rat | ENSRNOG00000010849 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ADPRHL2 pAb (ATL-HPA027104 w/enhanced validation) | |
| Datasheet | Anti ADPRHL2 pAb (ATL-HPA027104 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ADPRHL2 pAb (ATL-HPA027104 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ADPRHL2 pAb (ATL-HPA027104 w/enhanced validation) | |
| Datasheet | Anti ADPRHL2 pAb (ATL-HPA027104 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ADPRHL2 pAb (ATL-HPA027104 w/enhanced validation) |
| Citations for Anti ADPRHL2 pAb (ATL-HPA027104 w/enhanced validation) – 5 Found |
| Fontana, Pietro; Bonfiglio, Juan José; Palazzo, Luca; Bartlett, Edward; Matic, Ivan; Ahel, Ivan. Serine ADP-ribosylation reversal by the hydrolase ARH3. Elife. 2017;6( 28650317) PubMed |
| Palazzo, Luca; Leidecker, Orsolya; Prokhorova, Evgeniia; Dauben, Helen; Matic, Ivan; Ahel, Ivan. Serine is the major residue for ADP-ribosylation upon DNA damage. Elife. 2018;7( 29480802) PubMed |
| Bartlett, Edward; Bonfiglio, Juan José; Prokhorova, Evgeniia; Colby, Thomas; Zobel, Florian; Ahel, Ivan; Matic, Ivan. Interplay of Histone Marks with Serine ADP-Ribosylation. Cell Reports. 2018;24(13):3488-3502.e5. PubMed |
| Hanzlikova, Hana; Prokhorova, Evgeniia; Krejcikova, Katerina; Cihlarova, Zuzana; Kalasova, Ilona; Kubovciak, Jan; Sachova, Jana; Hailstone, Richard; Brazina, Jan; Ghosh, Shereen; Cirak, Sebahattin; Gleeson, Joseph G; Ahel, Ivan; Caldecott, Keith W. Pathogenic ARH3 mutations result in ADP-ribose chromatin scars during DNA strand break repair. Nature Communications. 2020;11(1):3391. PubMed |
| Prokhorova, Evgeniia; Zobel, Florian; Smith, Rebecca; Zentout, Siham; Gibbs-Seymour, Ian; Schützenhofer, Kira; Peters, Alessandra; Groslambert, Joséphine; Zorzini, Valentina; Agnew, Thomas; Brognard, John; Nielsen, Michael L; Ahel, Dragana; Huet, Sébastien; Suskiewicz, Marcin J; Ahel, Ivan. Serine-linked PARP1 auto-modification controls PARP inhibitor response. Nature Communications. 2021;12(1):4055. PubMed |
No reviews have been added for this product.
Try browsing our complete catalog of products.
Atlas Antibodies
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SEHFLKQLLGHMEDLEGDAQSVLDARELGMEERPYSSRLKKIGELLDQASVTREEVVSELGNGIAAFESVPTAIYCFLR |
| Gene Sequence | SEHFLKQLLGHMEDLEGDAQSVLDARELGMEERPYSSRLKKIGELLDQASVTREEVVSELGNGIAAFESVPTAIYCFLR |
| Gene ID - Mouse | ENSMUSG00000042558 |
| Gene ID - Rat | ENSRNOG00000010849 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ADPRHL2 pAb (ATL-HPA027104 w/enhanced validation) | |
| Datasheet | Anti ADPRHL2 pAb (ATL-HPA027104 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ADPRHL2 pAb (ATL-HPA027104 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ADPRHL2 pAb (ATL-HPA027104 w/enhanced validation) | |
| Datasheet | Anti ADPRHL2 pAb (ATL-HPA027104 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ADPRHL2 pAb (ATL-HPA027104 w/enhanced validation) |
| Citations for Anti ADPRHL2 pAb (ATL-HPA027104 w/enhanced validation) – 5 Found |
| Fontana, Pietro; Bonfiglio, Juan José; Palazzo, Luca; Bartlett, Edward; Matic, Ivan; Ahel, Ivan. Serine ADP-ribosylation reversal by the hydrolase ARH3. Elife. 2017;6( 28650317) PubMed |
| Palazzo, Luca; Leidecker, Orsolya; Prokhorova, Evgeniia; Dauben, Helen; Matic, Ivan; Ahel, Ivan. Serine is the major residue for ADP-ribosylation upon DNA damage. Elife. 2018;7( 29480802) PubMed |
| Bartlett, Edward; Bonfiglio, Juan José; Prokhorova, Evgeniia; Colby, Thomas; Zobel, Florian; Ahel, Ivan; Matic, Ivan. Interplay of Histone Marks with Serine ADP-Ribosylation. Cell Reports. 2018;24(13):3488-3502.e5. PubMed |
| Hanzlikova, Hana; Prokhorova, Evgeniia; Krejcikova, Katerina; Cihlarova, Zuzana; Kalasova, Ilona; Kubovciak, Jan; Sachova, Jana; Hailstone, Richard; Brazina, Jan; Ghosh, Shereen; Cirak, Sebahattin; Gleeson, Joseph G; Ahel, Ivan; Caldecott, Keith W. Pathogenic ARH3 mutations result in ADP-ribose chromatin scars during DNA strand break repair. Nature Communications. 2020;11(1):3391. PubMed |
| Prokhorova, Evgeniia; Zobel, Florian; Smith, Rebecca; Zentout, Siham; Gibbs-Seymour, Ian; Schützenhofer, Kira; Peters, Alessandra; Groslambert, Joséphine; Zorzini, Valentina; Agnew, Thomas; Brognard, John; Nielsen, Michael L; Ahel, Dragana; Huet, Sébastien; Suskiewicz, Marcin J; Ahel, Ivan. Serine-linked PARP1 auto-modification controls PARP inhibitor response. Nature Communications. 2021;12(1):4055. PubMed |