Related products

No related products found

Try browsing our complete catalog of products.

Reviews 0

No reviews have been added for this product.

Reviews

Protein Description: AE binding protein 1
Gene Name: AEBP1
Alternative Gene Name: ACLP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020473: 75%, ENSRNOG00000013720: 77%
Entrez Gene ID: 165
Uniprot ID: Q8IUX7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application	IHC
Reactivity	Human
Clonality	Polyclonal
Host	Rabbit
Immunogen	PPVKPLLPPLPPDYGDGYVIPNYDDMDYYFGPPPPQKPDAERQTDEEKEELKKPKKEDSSPKEETDKWAVEKGKDH
Gene Sequence	PPVKPLLPPLPPDYGDGYVIPNYDDMDYYFGPPPPQKPDAERQTDEEKEELKKPKKEDSSPKEETDKWAVEKGKDH
Gene ID - Mouse	ENSMUSG00000020473
Gene ID - Rat	ENSRNOG00000013720
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AEBP1 pAb (ATL-HPA064970)
Datasheet	Anti AEBP1 pAb (ATL-HPA064970) Datasheet (External Link)
Vendor Page	Anti AEBP1 pAb (ATL-HPA064970) at Atlas Antibodies

Documents & Links for Anti AEBP1 pAb (ATL-HPA064970)
Datasheet	Anti AEBP1 pAb (ATL-HPA064970) Datasheet (External Link)
Vendor Page	Anti AEBP1 pAb (ATL-HPA064970)

Citations for Anti AEBP1 pAb (ATL-HPA064970) – 1 Found

Caetano, Ana J; Yianni, Val; Volponi, Ana; Booth, Veronica; D'Agostino, Eleanor M; Sharpe, Paul. Defining human mesenchymal and epithelial heterogeneity in response to oral inflammatory disease. Elife. 2021;10( 33393902) PubMed

No related products found

Reviews 0

Reviews

Anti AEBP1 pAb (ATL-HPA064970)

Additional information

Anti AEBP1 pAb (ATL-HPA064970)

Additional information

Specifications

No related products found

Reviews 0

Anti AEBP1 pAb (ATL-HPA064970)

Additional information

Specifications

Anti AEBP1 pAb (ATL-HPA064970)

Additional information

Specifications

Specifications