Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ASHVFKFVDPSQDHALAKRSVDGGLMVKGPRHKPGIVQETTFDLGGDIHSGTALPTSKSTTRLDSDRVSSASSTAERGMVKPMIRVEQQPDYRRQESRTQD |
| Gene Sequence | ASHVFKFVDPSQDHALAKRSVDGGLMVKGPRHKPGIVQETTFDLGGDIHSGTALPTSKSTTRLDSDRVSSASSTAERGMVKPMIRVEQQPDYRRQESRTQD |
| Gene ID - Mouse | ENSMUSG00000068036 |
| Gene ID - Rat | ENSRNOG00000023753 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AFDN pAb (ATL-HPA030212) | |
| Datasheet | Anti AFDN pAb (ATL-HPA030212) Datasheet (External Link) |
| Vendor Page | Anti AFDN pAb (ATL-HPA030212) at Atlas Antibodies |
| Documents & Links for Anti AFDN pAb (ATL-HPA030212) | |
| Datasheet | Anti AFDN pAb (ATL-HPA030212) Datasheet (External Link) |
| Vendor Page | Anti AFDN pAb (ATL-HPA030212) |
| Citations for Anti AFDN pAb (ATL-HPA030212) – 2 Found |
| Tabariès, Sébastien; McNulty, Alexander; Ouellet, Véronique; Annis, Matthew G; Dessureault, Mireille; Vinette, Maude; Hachem, Yasmina; Lavoie, Brennan; Omeroglu, Atilla; Simon, Hans-Georg; Walsh, Logan A; Kimbung, Siker; Hedenfalk, Ingrid; Siegel, Peter M. Afadin cooperates with Claudin-2 to promote breast cancer metastasis. Genes & Development. 2019;33(3-4):180-193. PubMed |
| Labernadie, Anna; Kato, Takuya; Brugués, Agustí; Serra-Picamal, Xavier; Derzsi, Stefanie; Arwert, Esther; Weston, Anne; González-Tarragó, Victor; Elosegui-Artola, Alberto; Albertazzi, Lorenzo; Alcaraz, Jordi; Roca-Cusachs, Pere; Sahai, Erik; Trepat, Xavier. A mechanically active heterotypic E-cadherin/N-cadherin adhesion enables fibroblasts to drive cancer cell invasion. Nature Cell Biology. 2017;19(3):224-237. PubMed |
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ASHVFKFVDPSQDHALAKRSVDGGLMVKGPRHKPGIVQETTFDLGGDIHSGTALPTSKSTTRLDSDRVSSASSTAERGMVKPMIRVEQQPDYRRQESRTQD |
| Gene Sequence | ASHVFKFVDPSQDHALAKRSVDGGLMVKGPRHKPGIVQETTFDLGGDIHSGTALPTSKSTTRLDSDRVSSASSTAERGMVKPMIRVEQQPDYRRQESRTQD |
| Gene ID - Mouse | ENSMUSG00000068036 |
| Gene ID - Rat | ENSRNOG00000023753 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AFDN pAb (ATL-HPA030212) | |
| Datasheet | Anti AFDN pAb (ATL-HPA030212) Datasheet (External Link) |
| Vendor Page | Anti AFDN pAb (ATL-HPA030212) at Atlas Antibodies |
| Documents & Links for Anti AFDN pAb (ATL-HPA030212) | |
| Datasheet | Anti AFDN pAb (ATL-HPA030212) Datasheet (External Link) |
| Vendor Page | Anti AFDN pAb (ATL-HPA030212) |
| Citations for Anti AFDN pAb (ATL-HPA030212) – 2 Found |
| Tabariès, Sébastien; McNulty, Alexander; Ouellet, Véronique; Annis, Matthew G; Dessureault, Mireille; Vinette, Maude; Hachem, Yasmina; Lavoie, Brennan; Omeroglu, Atilla; Simon, Hans-Georg; Walsh, Logan A; Kimbung, Siker; Hedenfalk, Ingrid; Siegel, Peter M. Afadin cooperates with Claudin-2 to promote breast cancer metastasis. Genes & Development. 2019;33(3-4):180-193. PubMed |
| Labernadie, Anna; Kato, Takuya; Brugués, Agustí; Serra-Picamal, Xavier; Derzsi, Stefanie; Arwert, Esther; Weston, Anne; González-Tarragó, Victor; Elosegui-Artola, Alberto; Albertazzi, Lorenzo; Alcaraz, Jordi; Roca-Cusachs, Pere; Sahai, Erik; Trepat, Xavier. A mechanically active heterotypic E-cadherin/N-cadherin adhesion enables fibroblasts to drive cancer cell invasion. Nature Cell Biology. 2017;19(3):224-237. PubMed |