Loading...
Loading...
Loading...
Loading...
No reviews have been added for this product.
Atlas Antibodies


![Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: Human Esophagus tissue](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/47910/30225/atl-hpa030213_anti-afdn-pab-atl-hpa030213_41166__07861.1783631942.jpg?compression=lossy)


![Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: Human Esophagus tissue](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/47910/30225/atl-hpa030213_anti-afdn-pab-atl-hpa030213_41166__07861.1783631942.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KPEKPSTLQRPQETVIRELQPQQQPRTIERRDLQYITVSKEELSSGDSLSPDPWKRDAKEKLEKQQQMHIVDMLSKEIQELQSKPDRSAEESDRLRKLMLEWQ |
| Gene Sequence | KPEKPSTLQRPQETVIRELQPQQQPRTIERRDLQYITVSKEELSSGDSLSPDPWKRDAKEKLEKQQQMHIVDMLSKEIQELQSKPDRSAEESDRLRKLMLEWQ |
| Gene ID - Mouse | ENSMUSG00000068036 |
| Gene ID - Rat | ENSRNOG00000023753 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AFDN pAb (ATL-HPA030213) | |
| Datasheet | Anti AFDN pAb (ATL-HPA030213) Datasheet (External Link) |
| Vendor Page | Anti AFDN pAb (ATL-HPA030213) at Atlas Antibodies |
| Documents & Links for Anti AFDN pAb (ATL-HPA030213) | |
| Datasheet | Anti AFDN pAb (ATL-HPA030213) Datasheet (External Link) |
| Vendor Page | Anti AFDN pAb (ATL-HPA030213) |
| Citations for Anti AFDN pAb (ATL-HPA030213) – 1 Found |
| Marques, Miguel Sardinha; Melo, Joana; Cavadas, Bruno; Mendes, Nuno; Pereira, Luísa; Carneiro, Fátima; Figueiredo, Ceu; Leite, Marina. Afadin Downregulation by Helicobacter pylori Induces Epithelial to Mesenchymal Transition in Gastric Cells. Frontiers In Microbiology. 9( 30473688):2712. PubMed |
Try browsing our complete catalog of products.
Atlas Antibodies


![Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: Human Esophagus tissue](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/47910/30225/atl-hpa030213_anti-afdn-pab-atl-hpa030213_41166__07861.1783631942.jpg?compression=lossy)


![Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: Human Esophagus tissue](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/47910/30225/atl-hpa030213_anti-afdn-pab-atl-hpa030213_41166__07861.1783631942.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KPEKPSTLQRPQETVIRELQPQQQPRTIERRDLQYITVSKEELSSGDSLSPDPWKRDAKEKLEKQQQMHIVDMLSKEIQELQSKPDRSAEESDRLRKLMLEWQ |
| Gene Sequence | KPEKPSTLQRPQETVIRELQPQQQPRTIERRDLQYITVSKEELSSGDSLSPDPWKRDAKEKLEKQQQMHIVDMLSKEIQELQSKPDRSAEESDRLRKLMLEWQ |
| Gene ID - Mouse | ENSMUSG00000068036 |
| Gene ID - Rat | ENSRNOG00000023753 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AFDN pAb (ATL-HPA030213) | |
| Datasheet | Anti AFDN pAb (ATL-HPA030213) Datasheet (External Link) |
| Vendor Page | Anti AFDN pAb (ATL-HPA030213) at Atlas Antibodies |
| Documents & Links for Anti AFDN pAb (ATL-HPA030213) | |
| Datasheet | Anti AFDN pAb (ATL-HPA030213) Datasheet (External Link) |
| Vendor Page | Anti AFDN pAb (ATL-HPA030213) |
| Citations for Anti AFDN pAb (ATL-HPA030213) – 1 Found |
| Marques, Miguel Sardinha; Melo, Joana; Cavadas, Bruno; Mendes, Nuno; Pereira, Luísa; Carneiro, Fátima; Figueiredo, Ceu; Leite, Marina. Afadin Downregulation by Helicobacter pylori Induces Epithelial to Mesenchymal Transition in Gastric Cells. Frontiers In Microbiology. 9( 30473688):2712. PubMed |