Loading...
Loading...
Loading...
Loading...
Atlas Antibodies
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QIELTGKRYPLSGMGLPTFKEWIQNTLGVNVEHKTTSKASLNPSDTPPSVVNEDFLHDLKETNISYSQEADDRVFRAHGHCLH |
| Gene Sequence | QIELTGKRYPLSGMGLPTFKEWIQNTLGVNVEHKTTSKASLNPSDTPPSVVNEDFLHDLKETNISYSQEADDRVFRAHGHCLH |
| Gene ID - Mouse | ENSMUSG00000042410 |
| Gene ID - Rat | ENSRNOG00000001547 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AGPS pAb (ATL-HPA030209) | |
| Datasheet | Anti AGPS pAb (ATL-HPA030209) Datasheet (External Link) |
| Vendor Page | Anti AGPS pAb (ATL-HPA030209) at Atlas Antibodies |
| Documents & Links for Anti AGPS pAb (ATL-HPA030209) | |
| Datasheet | Anti AGPS pAb (ATL-HPA030209) Datasheet (External Link) |
| Vendor Page | Anti AGPS pAb (ATL-HPA030209) |
| Citations for Anti AGPS pAb (ATL-HPA030209) – 2 Found |
| Gan, Esther Shuyi; Cheong, Wei Fun; Chan, Kuan Rong; Ong, Eugenia Ziying; Chai, Xiaoran; Tan, Hwee Cheng; Ghosh, Sujoy; Wenk, Markus R; Ooi, Eng Eong. Hypoxia enhances antibody-dependent dengue virus infection. The Embo Journal. 2017;36(10):1348-1363. PubMed |
| Bestard-Escalas, Joan; Maimó-Barceló, Albert; Lopez, Daniel H; Reigada, Rebeca; Guardiola-Serrano, Francisca; Ramos-Vivas, José; Hornemann, Thorsten; Okazaki, Toshiro; Barceló-Coblijn, Gwendolyn. Common and Differential Traits of the Membrane Lipidome of Colon Cancer Cell Lines and their Secreted Vesicles: Impact on Studies Using Cell Lines. Cancers. 2020;12(5) PubMed |
Try browsing our complete catalog of products.
Atlas Antibodies
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QIELTGKRYPLSGMGLPTFKEWIQNTLGVNVEHKTTSKASLNPSDTPPSVVNEDFLHDLKETNISYSQEADDRVFRAHGHCLH |
| Gene Sequence | QIELTGKRYPLSGMGLPTFKEWIQNTLGVNVEHKTTSKASLNPSDTPPSVVNEDFLHDLKETNISYSQEADDRVFRAHGHCLH |
| Gene ID - Mouse | ENSMUSG00000042410 |
| Gene ID - Rat | ENSRNOG00000001547 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AGPS pAb (ATL-HPA030209) | |
| Datasheet | Anti AGPS pAb (ATL-HPA030209) Datasheet (External Link) |
| Vendor Page | Anti AGPS pAb (ATL-HPA030209) at Atlas Antibodies |
| Documents & Links for Anti AGPS pAb (ATL-HPA030209) | |
| Datasheet | Anti AGPS pAb (ATL-HPA030209) Datasheet (External Link) |
| Vendor Page | Anti AGPS pAb (ATL-HPA030209) |
| Citations for Anti AGPS pAb (ATL-HPA030209) – 2 Found |
| Gan, Esther Shuyi; Cheong, Wei Fun; Chan, Kuan Rong; Ong, Eugenia Ziying; Chai, Xiaoran; Tan, Hwee Cheng; Ghosh, Sujoy; Wenk, Markus R; Ooi, Eng Eong. Hypoxia enhances antibody-dependent dengue virus infection. The Embo Journal. 2017;36(10):1348-1363. PubMed |
| Bestard-Escalas, Joan; Maimó-Barceló, Albert; Lopez, Daniel H; Reigada, Rebeca; Guardiola-Serrano, Francisca; Ramos-Vivas, José; Hornemann, Thorsten; Okazaki, Toshiro; Barceló-Coblijn, Gwendolyn. Common and Differential Traits of the Membrane Lipidome of Colon Cancer Cell Lines and their Secreted Vesicles: Impact on Studies Using Cell Lines. Cancers. 2020;12(5) PubMed |
No reviews have been added for this product.