Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DVRGKGLMIGIEMVQDKISCRPLPREEVNQIHEDCKHMGLLVGRGSIFSQTFRIAPSMCITKPEVDFAVEVFRSALTQHMERRAK |
| Gene Sequence | DVRGKGLMIGIEMVQDKISCRPLPREEVNQIHEDCKHMGLLVGRGSIFSQTFRIAPSMCITKPEVDFAVEVFRSALTQHMERRAK |
| Gene ID - Mouse | ENSMUSG00000089678 |
| Gene ID - Rat | ENSRNOG00000017821 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AGXT2 pAb (ATL-HPA037382 w/enhanced validation) | |
| Datasheet | Anti AGXT2 pAb (ATL-HPA037382 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti AGXT2 pAb (ATL-HPA037382 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti AGXT2 pAb (ATL-HPA037382 w/enhanced validation) | |
| Datasheet | Anti AGXT2 pAb (ATL-HPA037382 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti AGXT2 pAb (ATL-HPA037382 w/enhanced validation) |
| Citations for Anti AGXT2 pAb (ATL-HPA037382 w/enhanced validation) – 4 Found |
| Kittel, Anja; Müller, Fabian; König, Jörg; Mieth, Maren; Sticht, Heinrich; Zolk, Oliver; Kralj, Ana; Heinrich, Markus R; Fromm, Martin F; Maas, Renke. Alanine-glyoxylate aminotransferase 2 (AGXT2) polymorphisms have considerable impact on methylarginine and β-aminoisobutyrate metabolism in healthy volunteers. Plos One. 9(2):e88544. PubMed |
| Rodionov, Roman N; Oppici, Elisa; Martens-Lobenhoffer, Jens; Jarzebska, Natalia; Brilloff, Silke; Burdin, Dmitrii; Demyanov, Anton; Kolouschek, Anne; Leiper, James; Maas, Renke; Cellini, Barbara; Weiss, Norbert; Bode-Böger, Stefanie M. A Novel Pathway for Metabolism of the Cardiovascular Risk Factor Homoarginine by alanine:glyoxylate aminotransferase 2. Scientific Reports. 2016;6( 27752063):35277. PubMed |
| Cai, Fei-Fei; Song, Ya-Nan; Lu, Yi-Yu; Zhang, Yongyu; Hu, Yi-Yang; Su, Shi-Bing. Analysis of plasma metabolic profile, characteristics and enzymes in the progression from chronic hepatitis B to hepatocellular carcinoma. Aging. 2020;12(14):14949-14965. PubMed |
| Wei, Jinshuang; Zhang, Junlin; Wei, Junyu; Hu, Miaoyue; Chen, Xiuqi; Qin, Xuankai; Chen, Jie; Lei, Fengying; Qin, Yuanhan. Identification of AGXT2, SHMT1, and ACO2 as important biomarkers of acute kidney injury by WGCNA. Plos One. 18(2):e0281439. PubMed |
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DVRGKGLMIGIEMVQDKISCRPLPREEVNQIHEDCKHMGLLVGRGSIFSQTFRIAPSMCITKPEVDFAVEVFRSALTQHMERRAK |
| Gene Sequence | DVRGKGLMIGIEMVQDKISCRPLPREEVNQIHEDCKHMGLLVGRGSIFSQTFRIAPSMCITKPEVDFAVEVFRSALTQHMERRAK |
| Gene ID - Mouse | ENSMUSG00000089678 |
| Gene ID - Rat | ENSRNOG00000017821 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AGXT2 pAb (ATL-HPA037382 w/enhanced validation) | |
| Datasheet | Anti AGXT2 pAb (ATL-HPA037382 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti AGXT2 pAb (ATL-HPA037382 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti AGXT2 pAb (ATL-HPA037382 w/enhanced validation) | |
| Datasheet | Anti AGXT2 pAb (ATL-HPA037382 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti AGXT2 pAb (ATL-HPA037382 w/enhanced validation) |
| Citations for Anti AGXT2 pAb (ATL-HPA037382 w/enhanced validation) – 4 Found |
| Kittel, Anja; Müller, Fabian; König, Jörg; Mieth, Maren; Sticht, Heinrich; Zolk, Oliver; Kralj, Ana; Heinrich, Markus R; Fromm, Martin F; Maas, Renke. Alanine-glyoxylate aminotransferase 2 (AGXT2) polymorphisms have considerable impact on methylarginine and β-aminoisobutyrate metabolism in healthy volunteers. Plos One. 9(2):e88544. PubMed |
| Rodionov, Roman N; Oppici, Elisa; Martens-Lobenhoffer, Jens; Jarzebska, Natalia; Brilloff, Silke; Burdin, Dmitrii; Demyanov, Anton; Kolouschek, Anne; Leiper, James; Maas, Renke; Cellini, Barbara; Weiss, Norbert; Bode-Böger, Stefanie M. A Novel Pathway for Metabolism of the Cardiovascular Risk Factor Homoarginine by alanine:glyoxylate aminotransferase 2. Scientific Reports. 2016;6( 27752063):35277. PubMed |
| Cai, Fei-Fei; Song, Ya-Nan; Lu, Yi-Yu; Zhang, Yongyu; Hu, Yi-Yang; Su, Shi-Bing. Analysis of plasma metabolic profile, characteristics and enzymes in the progression from chronic hepatitis B to hepatocellular carcinoma. Aging. 2020;12(14):14949-14965. PubMed |
| Wei, Jinshuang; Zhang, Junlin; Wei, Junyu; Hu, Miaoyue; Chen, Xiuqi; Qin, Xuankai; Chen, Jie; Lei, Fengying; Qin, Yuanhan. Identification of AGXT2, SHMT1, and ACO2 as important biomarkers of acute kidney injury by WGCNA. Plos One. 18(2):e0281439. PubMed |