Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HLEMKKMISEVTGGVSDTISYRDFVNMMLGKRSAVLKLVMMFEGKANESSPKPVGPPPERDIASLP |
| Gene Sequence | HLEMKKMISEVTGGVSDTISYRDFVNMMLGKRSAVLKLVMMFEGKANESSPKPVGPPPERDIASLP |
| Gene ID - Mouse | ENSMUSG00000001864 |
| Gene ID - Rat | ENSRNOG00000009951 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AIF1L pAb (ATL-HPA020522 w/enhanced validation) | |
| Datasheet | Anti AIF1L pAb (ATL-HPA020522 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti AIF1L pAb (ATL-HPA020522 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti AIF1L pAb (ATL-HPA020522 w/enhanced validation) | |
| Datasheet | Anti AIF1L pAb (ATL-HPA020522 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti AIF1L pAb (ATL-HPA020522 w/enhanced validation) |
| Citations for Anti AIF1L pAb (ATL-HPA020522 w/enhanced validation) – 3 Found |
| Liu, Peipei; Li, Wenhui; Hu, Yuanyuan; Jiang, Youhong. Absence of AIF1L contributes to cell migration and a poor prognosis of breast cancer. Oncotargets And Therapy. 11( 30233209):5485-5498. PubMed |
| Parikh, Dippal; Riascos-Bernal, Dario F; Egaña-Gorroño, Lander; Jayakumar, Smitha; Almonte, Vanessa; Chinnasamy, Prameladevi; Sibinga, Nicholas E S. Allograft inflammatory factor-1-like is not essential for age dependent weight gain or HFD-induced obesity and glucose insensitivity. Scientific Reports. 2020;10(1):3594. PubMed |
| Parikh, Dippal; Jayakumar, Smitha; Oliveira-Paula, Gustavo H; Almonte, Vanessa; Riascos-Bernal, Dario F; Sibinga, Nicholas E S. Allograft inflammatory factor-1-like is a situational regulator of leptin levels, hyperphagia, and obesity. Iscience. 2022;25(10):105058. PubMed |
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HLEMKKMISEVTGGVSDTISYRDFVNMMLGKRSAVLKLVMMFEGKANESSPKPVGPPPERDIASLP |
| Gene Sequence | HLEMKKMISEVTGGVSDTISYRDFVNMMLGKRSAVLKLVMMFEGKANESSPKPVGPPPERDIASLP |
| Gene ID - Mouse | ENSMUSG00000001864 |
| Gene ID - Rat | ENSRNOG00000009951 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AIF1L pAb (ATL-HPA020522 w/enhanced validation) | |
| Datasheet | Anti AIF1L pAb (ATL-HPA020522 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti AIF1L pAb (ATL-HPA020522 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti AIF1L pAb (ATL-HPA020522 w/enhanced validation) | |
| Datasheet | Anti AIF1L pAb (ATL-HPA020522 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti AIF1L pAb (ATL-HPA020522 w/enhanced validation) |
| Citations for Anti AIF1L pAb (ATL-HPA020522 w/enhanced validation) – 3 Found |
| Liu, Peipei; Li, Wenhui; Hu, Yuanyuan; Jiang, Youhong. Absence of AIF1L contributes to cell migration and a poor prognosis of breast cancer. Oncotargets And Therapy. 11( 30233209):5485-5498. PubMed |
| Parikh, Dippal; Riascos-Bernal, Dario F; Egaña-Gorroño, Lander; Jayakumar, Smitha; Almonte, Vanessa; Chinnasamy, Prameladevi; Sibinga, Nicholas E S. Allograft inflammatory factor-1-like is not essential for age dependent weight gain or HFD-induced obesity and glucose insensitivity. Scientific Reports. 2020;10(1):3594. PubMed |
| Parikh, Dippal; Jayakumar, Smitha; Oliveira-Paula, Gustavo H; Almonte, Vanessa; Riascos-Bernal, Dario F; Sibinga, Nicholas E S. Allograft inflammatory factor-1-like is a situational regulator of leptin levels, hyperphagia, and obesity. Iscience. 2022;25(10):105058. PubMed |