Loading...
Loading...
Loading...
Loading...
No reviews have been added for this product.
Atlas Antibodies
![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/44549/23827/atl-hpa018479_anti-ak2-pab-atl-hpa018479_34585__82447.1783627270.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRR |
| Gene Sequence | LAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRR |
| Gene ID - Mouse | ENSMUSG00000028792 |
| Gene ID - Rat | ENSRNOG00000000122 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AK2 pAb (ATL-HPA018479) | |
| Datasheet | Anti AK2 pAb (ATL-HPA018479) Datasheet (External Link) |
| Vendor Page | Anti AK2 pAb (ATL-HPA018479) at Atlas Antibodies |
| Documents & Links for Anti AK2 pAb (ATL-HPA018479) | |
| Datasheet | Anti AK2 pAb (ATL-HPA018479) Datasheet (External Link) |
| Vendor Page | Anti AK2 pAb (ATL-HPA018479) |
| Citations for Anti AK2 pAb (ATL-HPA018479) – 1 Found |
| Edwards-Hicks, Joy; Su, Huizhong; Mangolini, Maurizio; Yoneten, Kubra K; Wills, Jimi; Rodriguez-Blanco, Giovanny; Young, Christine; Cho, Kevin; Barker, Heather; Muir, Morwenna; Guerrieri, Ania Naila; Li, Xue-Feng; White, Rachel; Manasterski, Piotr; Mandrou, Elena; Wills, Karen; Chen, Jingyu; Abraham, Emily; Sateri, Kianoosh; Qian, Bin-Zhi; Bankhead, Peter; Arends, Mark; Gammoh, Noor; von Kriegsheim, Alex; Patti, Gary J; Sims, Andrew H; Acosta, Juan Carlos; Brunton, Valerie; Kranc, Kamil R; Christophorou, Maria; Pearce, Erika L; Ringshausen, Ingo; Finch, Andrew J. MYC sensitises cells to apoptosis by driving energetic demand. Nature Communications. 2022;13(1):4674. PubMed |
Atlas Antibodies
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRR |
| Gene Sequence | LAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRR |
| Gene ID - Mouse | ENSMUSG00000028792 |
| Gene ID - Rat | ENSRNOG00000000122 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AK2 pAb (ATL-HPA018479) | |
| Datasheet | Anti AK2 pAb (ATL-HPA018479) Datasheet (External Link) |
| Vendor Page | Anti AK2 pAb (ATL-HPA018479) at Atlas Antibodies |
| Documents & Links for Anti AK2 pAb (ATL-HPA018479) | |
| Datasheet | Anti AK2 pAb (ATL-HPA018479) Datasheet (External Link) |
| Vendor Page | Anti AK2 pAb (ATL-HPA018479) |
| Citations for Anti AK2 pAb (ATL-HPA018479) – 1 Found |
| Edwards-Hicks, Joy; Su, Huizhong; Mangolini, Maurizio; Yoneten, Kubra K; Wills, Jimi; Rodriguez-Blanco, Giovanny; Young, Christine; Cho, Kevin; Barker, Heather; Muir, Morwenna; Guerrieri, Ania Naila; Li, Xue-Feng; White, Rachel; Manasterski, Piotr; Mandrou, Elena; Wills, Karen; Chen, Jingyu; Abraham, Emily; Sateri, Kianoosh; Qian, Bin-Zhi; Bankhead, Peter; Arends, Mark; Gammoh, Noor; von Kriegsheim, Alex; Patti, Gary J; Sims, Andrew H; Acosta, Juan Carlos; Brunton, Valerie; Kranc, Kamil R; Christophorou, Maria; Pearce, Erika L; Ringshausen, Ingo; Finch, Andrew J. MYC sensitises cells to apoptosis by driving energetic demand. Nature Communications. 2022;13(1):4674. PubMed |
Try browsing our complete catalog of products.