Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies




| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EHVLELENSKGPSLASLEGEEDKGKSSSSQVVGPVQEEEYVAEKLPSRFIESAHTELAKDDAAPAPPVADAKAQDRGVEGELGNEESLDRNEEGLDRNEEGLDRNEESLDRNEEGLDRNEEIKRAAFQIISQVISEATEQV |
| Gene Sequence | EHVLELENSKGPSLASLEGEEDKGKSSSSQVVGPVQEEEYVAEKLPSRFIESAHTELAKDDAAPAPPVADAKAQDRGVEGELGNEESLDRNEEGLDRNEEGLDRNEESLDRNEEGLDRNEEIKRAAFQIISQVISEATEQV |
| Gene ID - Mouse | ENSMUSG00000018428 |
| Gene ID - Rat | ENSRNOG00000002373 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AKAP1 pAb (ATL-HPA008691) | |
| Datasheet | Anti AKAP1 pAb (ATL-HPA008691) Datasheet (External Link) |
| Vendor Page | Anti AKAP1 pAb (ATL-HPA008691) at Atlas Antibodies |
| Documents & Links for Anti AKAP1 pAb (ATL-HPA008691) | |
| Datasheet | Anti AKAP1 pAb (ATL-HPA008691) Datasheet (External Link) |
| Vendor Page | Anti AKAP1 pAb (ATL-HPA008691) |
| Citations for Anti AKAP1 pAb (ATL-HPA008691) – 3 Found |
| Sotgia, Federica; Whitaker-Menezes, Diana; Martinez-Outschoorn, Ubaldo E; Salem, Ahmed F; Tsirigos, Aristotelis; Lamb, Rebecca; Sneddon, Sharon; Hulit, James; Howell, Anthony; Lisanti, Michael P. Mitochondria "fuel" breast cancer metabolism: fifteen markers of mitochondrial biogenesis label epithelial cancer cells, but are excluded from adjacent stromal cells. Cell Cycle (Georgetown, Tex.). 2012;11(23):4390-401. PubMed |
| Aggarwal, Stacey; Gabrovsek, Laura; Langeberg, Lorene K; Golkowski, Martin; Ong, Shao-En; Smith, F Donelson; Scott, John D. Depletion of dAKAP1-protein kinase A signaling islands from the outer mitochondrial membrane alters breast cancer cell metabolism and motility. The Journal Of Biological Chemistry. 2019;294(9):3152-3168. PubMed |
| Signorelli, Mirko; Ayoglu, Burcu; Johansson, Camilla; Lochmüller, Hanns; Straub, Volker; Muntoni, Francesco; Niks, Erik; Tsonaka, Roula; Persson, Anja; Aartsma-Rus, Annemieke; Nilsson, Peter; Al-Khalili Szigyarto, Cristina; Spitali, Pietro. Longitudinal serum biomarker screening identifies malate dehydrogenase 2 as candidate prognostic biomarker for Duchenne muscular dystrophy. Journal Of Cachexia, Sarcopenia And Muscle. 2020;11(2):505-517. PubMed |




| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EHVLELENSKGPSLASLEGEEDKGKSSSSQVVGPVQEEEYVAEKLPSRFIESAHTELAKDDAAPAPPVADAKAQDRGVEGELGNEESLDRNEEGLDRNEEGLDRNEESLDRNEEGLDRNEEIKRAAFQIISQVISEATEQV |
| Gene Sequence | EHVLELENSKGPSLASLEGEEDKGKSSSSQVVGPVQEEEYVAEKLPSRFIESAHTELAKDDAAPAPPVADAKAQDRGVEGELGNEESLDRNEEGLDRNEEGLDRNEESLDRNEEGLDRNEEIKRAAFQIISQVISEATEQV |
| Gene ID - Mouse | ENSMUSG00000018428 |
| Gene ID - Rat | ENSRNOG00000002373 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AKAP1 pAb (ATL-HPA008691) | |
| Datasheet | Anti AKAP1 pAb (ATL-HPA008691) Datasheet (External Link) |
| Vendor Page | Anti AKAP1 pAb (ATL-HPA008691) at Atlas Antibodies |
| Documents & Links for Anti AKAP1 pAb (ATL-HPA008691) | |
| Datasheet | Anti AKAP1 pAb (ATL-HPA008691) Datasheet (External Link) |
| Vendor Page | Anti AKAP1 pAb (ATL-HPA008691) |
| Citations for Anti AKAP1 pAb (ATL-HPA008691) – 3 Found |
| Sotgia, Federica; Whitaker-Menezes, Diana; Martinez-Outschoorn, Ubaldo E; Salem, Ahmed F; Tsirigos, Aristotelis; Lamb, Rebecca; Sneddon, Sharon; Hulit, James; Howell, Anthony; Lisanti, Michael P. Mitochondria "fuel" breast cancer metabolism: fifteen markers of mitochondrial biogenesis label epithelial cancer cells, but are excluded from adjacent stromal cells. Cell Cycle (Georgetown, Tex.). 2012;11(23):4390-401. PubMed |
| Aggarwal, Stacey; Gabrovsek, Laura; Langeberg, Lorene K; Golkowski, Martin; Ong, Shao-En; Smith, F Donelson; Scott, John D. Depletion of dAKAP1-protein kinase A signaling islands from the outer mitochondrial membrane alters breast cancer cell metabolism and motility. The Journal Of Biological Chemistry. 2019;294(9):3152-3168. PubMed |
| Signorelli, Mirko; Ayoglu, Burcu; Johansson, Camilla; Lochmüller, Hanns; Straub, Volker; Muntoni, Francesco; Niks, Erik; Tsonaka, Roula; Persson, Anja; Aartsma-Rus, Annemieke; Nilsson, Peter; Al-Khalili Szigyarto, Cristina; Spitali, Pietro. Longitudinal serum biomarker screening identifies malate dehydrogenase 2 as candidate prognostic biomarker for Duchenne muscular dystrophy. Journal Of Cachexia, Sarcopenia And Muscle. 2020;11(2):505-517. PubMed |