Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies




| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | CTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNV |
| Gene Sequence | CTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNV |
| Gene ID - Mouse | ENSMUSG00000001642 |
| Gene ID - Rat | ENSRNOG00000009513 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AKR1B1 pAb (ATL-HPA026425 w/enhanced validation) | |
| Datasheet | Anti AKR1B1 pAb (ATL-HPA026425 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti AKR1B1 pAb (ATL-HPA026425 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti AKR1B1 pAb (ATL-HPA026425 w/enhanced validation) | |
| Datasheet | Anti AKR1B1 pAb (ATL-HPA026425 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti AKR1B1 pAb (ATL-HPA026425 w/enhanced validation) |
| Citations for Anti AKR1B1 pAb (ATL-HPA026425 w/enhanced validation) – 1 Found |
| Mateo-Otero, Yentel; Ribas-Maynou, Jordi; Delgado-Bermúdez, Ariadna; Llavanera, Marc; Recuero, Sandra; Barranco, Isabel; Yeste, Marc. Aldose Reductase B1 in Pig Sperm Is Related to Their Function and Fertilizing Ability. Frontiers In Endocrinology. 13( 35173684):773249. PubMed |




| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | CTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNV |
| Gene Sequence | CTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNV |
| Gene ID - Mouse | ENSMUSG00000001642 |
| Gene ID - Rat | ENSRNOG00000009513 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AKR1B1 pAb (ATL-HPA026425 w/enhanced validation) | |
| Datasheet | Anti AKR1B1 pAb (ATL-HPA026425 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti AKR1B1 pAb (ATL-HPA026425 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti AKR1B1 pAb (ATL-HPA026425 w/enhanced validation) | |
| Datasheet | Anti AKR1B1 pAb (ATL-HPA026425 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti AKR1B1 pAb (ATL-HPA026425 w/enhanced validation) |
| Citations for Anti AKR1B1 pAb (ATL-HPA026425 w/enhanced validation) – 1 Found |
| Mateo-Otero, Yentel; Ribas-Maynou, Jordi; Delgado-Bermúdez, Ariadna; Llavanera, Marc; Recuero, Sandra; Barranco, Isabel; Yeste, Marc. Aldose Reductase B1 in Pig Sperm Is Related to Their Function and Fertilizing Ability. Frontiers In Endocrinology. 13( 35173684):773249. PubMed |