Loading...
Loading...
Loading...
Loading...
No reviews have been added for this product.
Atlas Antibodies
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EEREEWTEAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLL |
| Gene Sequence | EEREEWTEAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLL |
| Gene ID - Mouse | ENSMUSG00000019699 |
| Gene ID - Rat | ENSRNOG00000021497 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AKT3 pAb (ATL-HPA026441) | |
| Datasheet | Anti AKT3 pAb (ATL-HPA026441) Datasheet (External Link) |
| Vendor Page | Anti AKT3 pAb (ATL-HPA026441) at Atlas Antibodies |
| Documents & Links for Anti AKT3 pAb (ATL-HPA026441) | |
| Datasheet | Anti AKT3 pAb (ATL-HPA026441) Datasheet (External Link) |
| Vendor Page | Anti AKT3 pAb (ATL-HPA026441) |
| Citations for Anti AKT3 pAb (ATL-HPA026441) – 3 Found |
| Vredeveld, Liesbeth C W; Possik, Patricia A; Smit, Marjon A; Meissl, Katrin; Michaloglou, Chrysiis; Horlings, Hugo M; Ajouaou, Abderrahim; Kortman, Pim C; Dankort, David; McMahon, Martin; Mooi, Wolter J; Peeper, Daniel S. Abrogation of BRAFV600E-induced senescence by PI3K pathway activation contributes to melanomagenesis. Genes & Development. 2012;26(10):1055-69. PubMed |
| Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. PubMed |
| O'Hurley, Gillian; Daly, Etáin; O'Grady, Anthony; Cummins, Robert; Quinn, Cecily; Flanagan, Louise; Pierce, Aisling; Fan, Yue; Lynn, Miriam A; Rafferty, Máirín; Fitzgerald, Dara; Pontén, Fredrik; Duffy, Michael J; Jirström, Karin; Kay, Elaine W; Gallagher, William M. Investigation of molecular alterations of AKT-3 in triple-negative breast cancer. Histopathology. 2014;64(5):660-70. PubMed |
Try browsing our complete catalog of products.
Atlas Antibodies
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EEREEWTEAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLL |
| Gene Sequence | EEREEWTEAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLL |
| Gene ID - Mouse | ENSMUSG00000019699 |
| Gene ID - Rat | ENSRNOG00000021497 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AKT3 pAb (ATL-HPA026441) | |
| Datasheet | Anti AKT3 pAb (ATL-HPA026441) Datasheet (External Link) |
| Vendor Page | Anti AKT3 pAb (ATL-HPA026441) at Atlas Antibodies |
| Documents & Links for Anti AKT3 pAb (ATL-HPA026441) | |
| Datasheet | Anti AKT3 pAb (ATL-HPA026441) Datasheet (External Link) |
| Vendor Page | Anti AKT3 pAb (ATL-HPA026441) |
| Citations for Anti AKT3 pAb (ATL-HPA026441) – 3 Found |
| Vredeveld, Liesbeth C W; Possik, Patricia A; Smit, Marjon A; Meissl, Katrin; Michaloglou, Chrysiis; Horlings, Hugo M; Ajouaou, Abderrahim; Kortman, Pim C; Dankort, David; McMahon, Martin; Mooi, Wolter J; Peeper, Daniel S. Abrogation of BRAFV600E-induced senescence by PI3K pathway activation contributes to melanomagenesis. Genes & Development. 2012;26(10):1055-69. PubMed |
| Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. PubMed |
| O'Hurley, Gillian; Daly, Etáin; O'Grady, Anthony; Cummins, Robert; Quinn, Cecily; Flanagan, Louise; Pierce, Aisling; Fan, Yue; Lynn, Miriam A; Rafferty, Máirín; Fitzgerald, Dara; Pontén, Fredrik; Duffy, Michael J; Jirström, Karin; Kay, Elaine W; Gallagher, William M. Investigation of molecular alterations of AKT-3 in triple-negative breast cancer. Histopathology. 2014;64(5):660-70. PubMed |