Loading...
Loading...
Loading...
Loading...
No reviews have been added for this product.
Atlas Antibodies
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFGGVGSSGMGAYHGKHSFDTFSHQRPCLLKSLKREGANKLRYPPNSQSKVDWGKFFLLKRFNKE |
| Gene Sequence | SHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFGGVGSSGMGAYHGKHSFDTFSHQRPCLLKSLKREGANKLRYPPNSQSKVDWGKFFLLKRFNKE |
| Gene ID - Mouse | ENSMUSG00000010025 |
| Gene ID - Rat | ENSRNOG00000002342 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ALDH3A2 pAb (ATL-HPA014769) | |
| Datasheet | Anti ALDH3A2 pAb (ATL-HPA014769) Datasheet (External Link) |
| Vendor Page | Anti ALDH3A2 pAb (ATL-HPA014769) at Atlas Antibodies |
| Documents & Links for Anti ALDH3A2 pAb (ATL-HPA014769) | |
| Datasheet | Anti ALDH3A2 pAb (ATL-HPA014769) Datasheet (External Link) |
| Vendor Page | Anti ALDH3A2 pAb (ATL-HPA014769) |
| Citations for Anti ALDH3A2 pAb (ATL-HPA014769) – 1 Found |
| Ghazalpour, Anatole; Bennett, Brian; Petyuk, Vladislav A; Orozco, Luz; Hagopian, Raffi; Mungrue, Imran N; Farber, Charles R; Sinsheimer, Janet; Kang, Hyun M; Furlotte, Nicholas; Park, Christopher C; Wen, Ping-Zi; Brewer, Heather; Weitz, Karl; Camp, David G 2nd; Pan, Calvin; Yordanova, Roumyana; Neuhaus, Isaac; Tilford, Charles; Siemers, Nathan; Gargalovic, Peter; Eskin, Eleazar; Kirchgessner, Todd; Smith, Desmond J; Smith, Richard D; Lusis, Aldons J. Comparative analysis of proteome and transcriptome variation in mouse. Plos Genetics. 2011;7(6):e1001393. PubMed |
Try browsing our complete catalog of products.
Atlas Antibodies
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFGGVGSSGMGAYHGKHSFDTFSHQRPCLLKSLKREGANKLRYPPNSQSKVDWGKFFLLKRFNKE |
| Gene Sequence | SHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFGGVGSSGMGAYHGKHSFDTFSHQRPCLLKSLKREGANKLRYPPNSQSKVDWGKFFLLKRFNKE |
| Gene ID - Mouse | ENSMUSG00000010025 |
| Gene ID - Rat | ENSRNOG00000002342 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ALDH3A2 pAb (ATL-HPA014769) | |
| Datasheet | Anti ALDH3A2 pAb (ATL-HPA014769) Datasheet (External Link) |
| Vendor Page | Anti ALDH3A2 pAb (ATL-HPA014769) at Atlas Antibodies |
| Documents & Links for Anti ALDH3A2 pAb (ATL-HPA014769) | |
| Datasheet | Anti ALDH3A2 pAb (ATL-HPA014769) Datasheet (External Link) |
| Vendor Page | Anti ALDH3A2 pAb (ATL-HPA014769) |
| Citations for Anti ALDH3A2 pAb (ATL-HPA014769) – 1 Found |
| Ghazalpour, Anatole; Bennett, Brian; Petyuk, Vladislav A; Orozco, Luz; Hagopian, Raffi; Mungrue, Imran N; Farber, Charles R; Sinsheimer, Janet; Kang, Hyun M; Furlotte, Nicholas; Park, Christopher C; Wen, Ping-Zi; Brewer, Heather; Weitz, Karl; Camp, David G 2nd; Pan, Calvin; Yordanova, Roumyana; Neuhaus, Isaac; Tilford, Charles; Siemers, Nathan; Gargalovic, Peter; Eskin, Eleazar; Kirchgessner, Todd; Smith, Desmond J; Smith, Richard D; Lusis, Aldons J. Comparative analysis of proteome and transcriptome variation in mouse. Plos Genetics. 2011;7(6):e1001393. PubMed |