Loading...
Loading...
Loading...
Loading...
No reviews have been added for this product.
Atlas Antibodies


| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SGLEKLKEIHYPPYTDWNQQLLRWGMGSQSCTLL |
| Gene Sequence | SGLEKLKEIHYPPYTDWNQQLLRWGMGSQSCTLL |
| Gene ID - Mouse | ENSMUSG00000037263 |
| Gene ID - Rat | ENSRNOG00000017872 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ALDH3B2 pAb (ATL-HPA045132 w/enhanced validation) | |
| Datasheet | Anti ALDH3B2 pAb (ATL-HPA045132 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ALDH3B2 pAb (ATL-HPA045132 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ALDH3B2 pAb (ATL-HPA045132 w/enhanced validation) | |
| Datasheet | Anti ALDH3B2 pAb (ATL-HPA045132 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ALDH3B2 pAb (ATL-HPA045132 w/enhanced validation) |
| Citations for Anti ALDH3B2 pAb (ATL-HPA045132 w/enhanced validation) – 1 Found |
| Han, Guanghui; Zhen, Weizhe; Dai, Yuan; Yu, Hongni; Li, Dongyue; Ma, Tao. Dihuang-Yinzi Alleviates Cognition Deficits via Targeting Energy-Related Metabolism in an Alzheimer Mouse Model as Demonstrated by Integration of Metabolomics and Network Pharmacology. Frontiers In Aging Neuroscience. 14( 35431901):873929. PubMed |
Try browsing our complete catalog of products.
Atlas Antibodies


| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SGLEKLKEIHYPPYTDWNQQLLRWGMGSQSCTLL |
| Gene Sequence | SGLEKLKEIHYPPYTDWNQQLLRWGMGSQSCTLL |
| Gene ID - Mouse | ENSMUSG00000037263 |
| Gene ID - Rat | ENSRNOG00000017872 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ALDH3B2 pAb (ATL-HPA045132 w/enhanced validation) | |
| Datasheet | Anti ALDH3B2 pAb (ATL-HPA045132 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ALDH3B2 pAb (ATL-HPA045132 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ALDH3B2 pAb (ATL-HPA045132 w/enhanced validation) | |
| Datasheet | Anti ALDH3B2 pAb (ATL-HPA045132 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ALDH3B2 pAb (ATL-HPA045132 w/enhanced validation) |
| Citations for Anti ALDH3B2 pAb (ATL-HPA045132 w/enhanced validation) – 1 Found |
| Han, Guanghui; Zhen, Weizhe; Dai, Yuan; Yu, Hongni; Li, Dongyue; Ma, Tao. Dihuang-Yinzi Alleviates Cognition Deficits via Targeting Energy-Related Metabolism in an Alzheimer Mouse Model as Demonstrated by Integration of Metabolomics and Network Pharmacology. Frontiers In Aging Neuroscience. 14( 35431901):873929. PubMed |