Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies






| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RCMALSTAVLVGEAKKWLPELVEHAKNLRVNAGDQPGADLGPLITPQAKERVCNLIDSGTKEGASILLDGRKIKVKGYENGNFVGPTIISNVKPNM |
| Gene Sequence | RCMALSTAVLVGEAKKWLPELVEHAKNLRVNAGDQPGADLGPLITPQAKERVCNLIDSGTKEGASILLDGRKIKVKGYENGNFVGPTIISNVKPNM |
| Gene ID - Mouse | ENSMUSG00000021238 |
| Gene ID - Rat | ENSRNOG00000011419 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ALDH6A1 pAb (ATL-HPA029073 w/enhanced validation) | |
| Datasheet | Anti ALDH6A1 pAb (ATL-HPA029073 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ALDH6A1 pAb (ATL-HPA029073 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ALDH6A1 pAb (ATL-HPA029073 w/enhanced validation) | |
| Datasheet | Anti ALDH6A1 pAb (ATL-HPA029073 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ALDH6A1 pAb (ATL-HPA029073 w/enhanced validation) |
| Citations for Anti ALDH6A1 pAb (ATL-HPA029073 w/enhanced validation) – 1 Found |
| Lu, Jun; Chen, Zhan; Zhao, Hu; Dong, Huiyue; Zhu, Ling; Zhang, Yi; Wang, Jie; Zhu, Hehuan; Cui, Qiang; Qi, Chuang; Wang, Shuiliang; Chen, Shushang; Shao, Jichun. ABAT and ALDH6A1, regulated by transcription factor HNF4A, suppress tumorigenic capability in clear cell renal cell carcinoma. Journal Of Translational Medicine. 2020;18(1):101. PubMed |






| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RCMALSTAVLVGEAKKWLPELVEHAKNLRVNAGDQPGADLGPLITPQAKERVCNLIDSGTKEGASILLDGRKIKVKGYENGNFVGPTIISNVKPNM |
| Gene Sequence | RCMALSTAVLVGEAKKWLPELVEHAKNLRVNAGDQPGADLGPLITPQAKERVCNLIDSGTKEGASILLDGRKIKVKGYENGNFVGPTIISNVKPNM |
| Gene ID - Mouse | ENSMUSG00000021238 |
| Gene ID - Rat | ENSRNOG00000011419 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ALDH6A1 pAb (ATL-HPA029073 w/enhanced validation) | |
| Datasheet | Anti ALDH6A1 pAb (ATL-HPA029073 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ALDH6A1 pAb (ATL-HPA029073 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ALDH6A1 pAb (ATL-HPA029073 w/enhanced validation) | |
| Datasheet | Anti ALDH6A1 pAb (ATL-HPA029073 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ALDH6A1 pAb (ATL-HPA029073 w/enhanced validation) |
| Citations for Anti ALDH6A1 pAb (ATL-HPA029073 w/enhanced validation) – 1 Found |
| Lu, Jun; Chen, Zhan; Zhao, Hu; Dong, Huiyue; Zhu, Ling; Zhang, Yi; Wang, Jie; Zhu, Hehuan; Cui, Qiang; Qi, Chuang; Wang, Shuiliang; Chen, Shushang; Shao, Jichun. ABAT and ALDH6A1, regulated by transcription factor HNF4A, suppress tumorigenic capability in clear cell renal cell carcinoma. Journal Of Translational Medicine. 2020;18(1):101. PubMed |