Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies


![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/45775/26268/atl-hpa023296_anti-aldh7a1-pab-atl-hpa023296-wenhanced-validation_37087__48077.1783629064.jpg?compression=lossy)


![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/45775/26268/atl-hpa023296_anti-aldh7a1-pab-atl-hpa023296-wenhanced-validation_37087__48077.1783629064.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DLSLVVPSALFAAVGTAGQRCTTARRLFIHESIHDEVVNRLKKAYAQIRVGNPWDPNVLYGPLHTKQAVSMFLGAVEEAKKEGGTVVYGGKVMDRPGNYVEPTIVTGLGHDASIAHTETFAPILY |
| Gene Sequence | DLSLVVPSALFAAVGTAGQRCTTARRLFIHESIHDEVVNRLKKAYAQIRVGNPWDPNVLYGPLHTKQAVSMFLGAVEEAKKEGGTVVYGGKVMDRPGNYVEPTIVTGLGHDASIAHTETFAPILY |
| Gene ID - Mouse | ENSMUSG00000053644 |
| Gene ID - Rat | ENSRNOG00000014645 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ALDH7A1 pAb (ATL-HPA023296 w/enhanced validation) | |
| Datasheet | Anti ALDH7A1 pAb (ATL-HPA023296 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ALDH7A1 pAb (ATL-HPA023296 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ALDH7A1 pAb (ATL-HPA023296 w/enhanced validation) | |
| Datasheet | Anti ALDH7A1 pAb (ATL-HPA023296 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ALDH7A1 pAb (ATL-HPA023296 w/enhanced validation) |
| Citations for Anti ALDH7A1 pAb (ATL-HPA023296 w/enhanced validation) – 2 Found |
| Andrejeva, Diana; Kugler, Jan-Michael; Nguyen, Hung Thanh; Malmendal, Anders; Holm, Mette Lind; Toft, Birgitte Groenkaer; Loya, Anand C; Cohen, Stephen M. Metabolic control of PPAR activity by aldehyde dehydrogenase regulates invasive cell behavior and predicts survival in hepatocellular and renal clear cell carcinoma. Bmc Cancer. 2018;18(1):1180. PubMed |
| Lu, Hsueh-Ju; Hsieh, Chih-Cheng; Yeh, Chi-Chun; Yeh, Yi-Chen; Wu, Chun-Chi; Wang, Feng-Sheng; Lai, Jin-Mei; Yang, Muh-Hwa; Wang, Cheng-Hsu; Huang, Chi-Ying F; Chang, Peter Mu-Hsin. Clinical, pathophysiologic, and genomic analysis of the outcomes of primary head and neck malignancy after pulmonary metastasectomy. Scientific Reports. 2019;9(1):12913. PubMed |


![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/45775/26268/atl-hpa023296_anti-aldh7a1-pab-atl-hpa023296-wenhanced-validation_37087__48077.1783629064.jpg?compression=lossy)


![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/45775/26268/atl-hpa023296_anti-aldh7a1-pab-atl-hpa023296-wenhanced-validation_37087__48077.1783629064.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DLSLVVPSALFAAVGTAGQRCTTARRLFIHESIHDEVVNRLKKAYAQIRVGNPWDPNVLYGPLHTKQAVSMFLGAVEEAKKEGGTVVYGGKVMDRPGNYVEPTIVTGLGHDASIAHTETFAPILY |
| Gene Sequence | DLSLVVPSALFAAVGTAGQRCTTARRLFIHESIHDEVVNRLKKAYAQIRVGNPWDPNVLYGPLHTKQAVSMFLGAVEEAKKEGGTVVYGGKVMDRPGNYVEPTIVTGLGHDASIAHTETFAPILY |
| Gene ID - Mouse | ENSMUSG00000053644 |
| Gene ID - Rat | ENSRNOG00000014645 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ALDH7A1 pAb (ATL-HPA023296 w/enhanced validation) | |
| Datasheet | Anti ALDH7A1 pAb (ATL-HPA023296 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ALDH7A1 pAb (ATL-HPA023296 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ALDH7A1 pAb (ATL-HPA023296 w/enhanced validation) | |
| Datasheet | Anti ALDH7A1 pAb (ATL-HPA023296 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ALDH7A1 pAb (ATL-HPA023296 w/enhanced validation) |
| Citations for Anti ALDH7A1 pAb (ATL-HPA023296 w/enhanced validation) – 2 Found |
| Andrejeva, Diana; Kugler, Jan-Michael; Nguyen, Hung Thanh; Malmendal, Anders; Holm, Mette Lind; Toft, Birgitte Groenkaer; Loya, Anand C; Cohen, Stephen M. Metabolic control of PPAR activity by aldehyde dehydrogenase regulates invasive cell behavior and predicts survival in hepatocellular and renal clear cell carcinoma. Bmc Cancer. 2018;18(1):1180. PubMed |
| Lu, Hsueh-Ju; Hsieh, Chih-Cheng; Yeh, Chi-Chun; Yeh, Yi-Chen; Wu, Chun-Chi; Wang, Feng-Sheng; Lai, Jin-Mei; Yang, Muh-Hwa; Wang, Cheng-Hsu; Huang, Chi-Ying F; Chang, Peter Mu-Hsin. Clinical, pathophysiologic, and genomic analysis of the outcomes of primary head and neck malignancy after pulmonary metastasectomy. Scientific Reports. 2019;9(1):12913. PubMed |