Loading...
Loading...
Loading...
Loading...
Atlas Antibodies
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KPNMVTAGHACTKKYTPEQVAMATVTALHRTVPAAVPGICFLSGGMSEEDATLNLNAINLCPLPKPWKLSFSYGRALQASALAAWGGKAANKEATQEAFMKRAMANCQAAKGQYVHTGSSGAA |
| Gene Sequence | KPNMVTAGHACTKKYTPEQVAMATVTALHRTVPAAVPGICFLSGGMSEEDATLNLNAINLCPLPKPWKLSFSYGRALQASALAAWGGKAANKEATQEAFMKRAMANCQAAKGQYVHTGSSGAA |
| Gene ID - Mouse | ENSMUSG00000028307 |
| Gene ID - Rat | ENSRNOG00000006807 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ALDOB pAb (ATL-HPA002198 w/enhanced validation) | |
| Datasheet | Anti ALDOB pAb (ATL-HPA002198 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ALDOB pAb (ATL-HPA002198 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ALDOB pAb (ATL-HPA002198 w/enhanced validation) | |
| Datasheet | Anti ALDOB pAb (ATL-HPA002198 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ALDOB pAb (ATL-HPA002198 w/enhanced validation) |
| Citations for Anti ALDOB pAb (ATL-HPA002198 w/enhanced validation) – 2 Found |
| Kampf, Caroline; Mardinoglu, Adil; Fagerberg, Linn; Hallström, Björn M; Edlund, Karolina; Lundberg, Emma; Pontén, Fredrik; Nielsen, Jens; Uhlen, Mathias. The human liver-specific proteome defined by transcriptomics and antibody-based profiling. Faseb Journal : Official Publication Of The Federation Of American Societies For Experimental Biology. 2014;28(7):2901-14. PubMed |
| Merkulova, Maria; Hurtado-Lorenzo, Andrés; Hosokawa, Hiroyuki; Zhuang, Zhenjie; Brown, Dennis; Ausiello, Dennis A; Marshansky, Vladimir. Aldolase directly interacts with ARNO and modulates cell morphology and acidic vesicle distribution. American Journal Of Physiology. Cell Physiology. 2011;300(6):C1442-55. PubMed |
No reviews have been added for this product.
Try browsing our complete catalog of products.
Atlas Antibodies
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KPNMVTAGHACTKKYTPEQVAMATVTALHRTVPAAVPGICFLSGGMSEEDATLNLNAINLCPLPKPWKLSFSYGRALQASALAAWGGKAANKEATQEAFMKRAMANCQAAKGQYVHTGSSGAA |
| Gene Sequence | KPNMVTAGHACTKKYTPEQVAMATVTALHRTVPAAVPGICFLSGGMSEEDATLNLNAINLCPLPKPWKLSFSYGRALQASALAAWGGKAANKEATQEAFMKRAMANCQAAKGQYVHTGSSGAA |
| Gene ID - Mouse | ENSMUSG00000028307 |
| Gene ID - Rat | ENSRNOG00000006807 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ALDOB pAb (ATL-HPA002198 w/enhanced validation) | |
| Datasheet | Anti ALDOB pAb (ATL-HPA002198 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ALDOB pAb (ATL-HPA002198 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ALDOB pAb (ATL-HPA002198 w/enhanced validation) | |
| Datasheet | Anti ALDOB pAb (ATL-HPA002198 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ALDOB pAb (ATL-HPA002198 w/enhanced validation) |
| Citations for Anti ALDOB pAb (ATL-HPA002198 w/enhanced validation) – 2 Found |
| Kampf, Caroline; Mardinoglu, Adil; Fagerberg, Linn; Hallström, Björn M; Edlund, Karolina; Lundberg, Emma; Pontén, Fredrik; Nielsen, Jens; Uhlen, Mathias. The human liver-specific proteome defined by transcriptomics and antibody-based profiling. Faseb Journal : Official Publication Of The Federation Of American Societies For Experimental Biology. 2014;28(7):2901-14. PubMed |
| Merkulova, Maria; Hurtado-Lorenzo, Andrés; Hosokawa, Hiroyuki; Zhuang, Zhenjie; Brown, Dennis; Ausiello, Dennis A; Marshansky, Vladimir. Aldolase directly interacts with ARNO and modulates cell morphology and acidic vesicle distribution. American Journal Of Physiology. Cell Physiology. 2011;300(6):C1442-55. PubMed |