Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies

![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/53079/39480/atl-hpa044087_anti-alkbh1-pab-atl-hpa044087_50684__10618.1783638416.jpg?compression=lossy)

![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/53079/39480/atl-hpa044087_anti-alkbh1-pab-atl-hpa044087_50684__10618.1783638416.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SMVEPCSLEDWQVCASYLKTARVNMTVRQVLATDQNFPLEPIEDEKRDISTEGFCHLDDQNSEVKRARIN |
| Gene Sequence | SMVEPCSLEDWQVCASYLKTARVNMTVRQVLATDQNFPLEPIEDEKRDISTEGFCHLDDQNSEVKRARIN |
| Gene ID - Mouse | ENSMUSG00000079036 |
| Gene ID - Rat | ENSRNOG00000012264 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ALKBH1 pAb (ATL-HPA044087) | |
| Datasheet | Anti ALKBH1 pAb (ATL-HPA044087) Datasheet (External Link) |
| Vendor Page | Anti ALKBH1 pAb (ATL-HPA044087) at Atlas Antibodies |
| Documents & Links for Anti ALKBH1 pAb (ATL-HPA044087) | |
| Datasheet | Anti ALKBH1 pAb (ATL-HPA044087) Datasheet (External Link) |
| Vendor Page | Anti ALKBH1 pAb (ATL-HPA044087) |
| Citations for Anti ALKBH1 pAb (ATL-HPA044087) – 1 Found |
| Malvi, Parmanand; Wang, Biao; Shah, Shreni; Gupta, Romi. Dissecting the role of RNA modification regulatory proteins in melanoma. Oncotarget. 2019;10(38):3745-3759. PubMed |

![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/53079/39480/atl-hpa044087_anti-alkbh1-pab-atl-hpa044087_50684__10618.1783638416.jpg?compression=lossy)

![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/53079/39480/atl-hpa044087_anti-alkbh1-pab-atl-hpa044087_50684__10618.1783638416.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SMVEPCSLEDWQVCASYLKTARVNMTVRQVLATDQNFPLEPIEDEKRDISTEGFCHLDDQNSEVKRARIN |
| Gene Sequence | SMVEPCSLEDWQVCASYLKTARVNMTVRQVLATDQNFPLEPIEDEKRDISTEGFCHLDDQNSEVKRARIN |
| Gene ID - Mouse | ENSMUSG00000079036 |
| Gene ID - Rat | ENSRNOG00000012264 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ALKBH1 pAb (ATL-HPA044087) | |
| Datasheet | Anti ALKBH1 pAb (ATL-HPA044087) Datasheet (External Link) |
| Vendor Page | Anti ALKBH1 pAb (ATL-HPA044087) at Atlas Antibodies |
| Documents & Links for Anti ALKBH1 pAb (ATL-HPA044087) | |
| Datasheet | Anti ALKBH1 pAb (ATL-HPA044087) Datasheet (External Link) |
| Vendor Page | Anti ALKBH1 pAb (ATL-HPA044087) |
| Citations for Anti ALKBH1 pAb (ATL-HPA044087) – 1 Found |
| Malvi, Parmanand; Wang, Biao; Shah, Shreni; Gupta, Romi. Dissecting the role of RNA modification regulatory proteins in melanoma. Oncotarget. 2019;10(38):3745-3759. PubMed |