Loading...
Loading...
Loading...
Loading...
No reviews have been added for this product.
Atlas Antibodies
![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/46515/27672/atl-hpa026592_anti-alox5ap-pab-atl-hpa026592-wenhanced-validation_38526__75978.1783630108.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVL |
| Gene Sequence | HKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVL |
| Gene ID - Mouse | ENSMUSG00000060063 |
| Gene ID - Rat | ENSRNOG00000000907 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ALOX5AP pAb (ATL-HPA026592 w/enhanced validation) | |
| Datasheet | Anti ALOX5AP pAb (ATL-HPA026592 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ALOX5AP pAb (ATL-HPA026592 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ALOX5AP pAb (ATL-HPA026592 w/enhanced validation) | |
| Datasheet | Anti ALOX5AP pAb (ATL-HPA026592 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ALOX5AP pAb (ATL-HPA026592 w/enhanced validation) |
| Citations for Anti ALOX5AP pAb (ATL-HPA026592 w/enhanced validation) – 1 Found |
| Perisic, Ljubica; Hedin, Erika; Razuvaev, Anton; Lengquist, Mariette; Osterholm, Cecilia; Folkersen, Lasse; Gillgren, Peter; Paulsson-Berne, Gabrielle; Ponten, Fredrik; Odeberg, Jacob; Hedin, Ulf. Profiling of atherosclerotic lesions by gene and tissue microarrays reveals PCSK6 as a novel protease in unstable carotid atherosclerosis. Arteriosclerosis, Thrombosis, And Vascular Biology. 2013;33(10):2432-43. PubMed |
Try browsing our complete catalog of products.
Atlas Antibodies
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVL |
| Gene Sequence | HKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVL |
| Gene ID - Mouse | ENSMUSG00000060063 |
| Gene ID - Rat | ENSRNOG00000000907 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ALOX5AP pAb (ATL-HPA026592 w/enhanced validation) | |
| Datasheet | Anti ALOX5AP pAb (ATL-HPA026592 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ALOX5AP pAb (ATL-HPA026592 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ALOX5AP pAb (ATL-HPA026592 w/enhanced validation) | |
| Datasheet | Anti ALOX5AP pAb (ATL-HPA026592 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ALOX5AP pAb (ATL-HPA026592 w/enhanced validation) |
| Citations for Anti ALOX5AP pAb (ATL-HPA026592 w/enhanced validation) – 1 Found |
| Perisic, Ljubica; Hedin, Erika; Razuvaev, Anton; Lengquist, Mariette; Osterholm, Cecilia; Folkersen, Lasse; Gillgren, Peter; Paulsson-Berne, Gabrielle; Ponten, Fredrik; Odeberg, Jacob; Hedin, Ulf. Profiling of atherosclerotic lesions by gene and tissue microarrays reveals PCSK6 as a novel protease in unstable carotid atherosclerosis. Arteriosclerosis, Thrombosis, And Vascular Biology. 2013;33(10):2432-43. PubMed |