Related products

No related products found

Try browsing our complete catalog of products.

Reviews 0

No reviews have been added for this product.

Reviews

Protein Description: alkaline phosphatase, intestinal
Gene Name: ALPI
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026246: 81%, ENSRNOG00000033672: 81%
Entrez Gene ID: 248
Uniprot ID: P09923
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application	IHC
Reactivity	Human
Clonality	Polyclonal
Host	Rabbit
Immunogen	FQTIGLSAAARFNQCNTTRGNEVISVMNRAK
Gene Sequence	FQTIGLSAAARFNQCNTTRGNEVISVMNRAK
Gene ID - Mouse	ENSMUSG00000026246
Gene ID - Rat	ENSRNOG00000033672
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ALPI pAb (ATL-HPA051699)
Datasheet	Anti ALPI pAb (ATL-HPA051699) Datasheet (External Link)
Vendor Page	Anti ALPI pAb (ATL-HPA051699) at Atlas Antibodies

Documents & Links for Anti ALPI pAb (ATL-HPA051699)
Datasheet	Anti ALPI pAb (ATL-HPA051699) Datasheet (External Link)
Vendor Page	Anti ALPI pAb (ATL-HPA051699)

Citations for Anti ALPI pAb (ATL-HPA051699) – 1 Found

Chen, Jian; Chen, Zhilu; Liu, Mingbin; Qiu, Tianyi; Feng, Daobin; Zhao, Chen; Zhang, Shuye; Zhang, Xiaoyan; Xu, Jianqing. Placental Alkaline Phosphatase Promotes Zika Virus Replication by Stabilizing Viral Proteins through BIP. Mbio. 2020;11(5) PubMed

No related products found

Reviews 0

Reviews

Anti ALPI pAb (ATL-HPA051699)

Additional information

Specifications

Reviews 0

Anti ALPI pAb (ATL-HPA051699)

Additional information

Specifications

No related products found

Anti ALPI pAb (ATL-HPA051699)

Additional information

Anti ALPI pAb (ATL-HPA051699)

Additional information

Specifications

Specifications