Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
Atlas Antibodies
Atlas Antibodies


![Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: Human Placenta tissue](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/50594/35052/atl-hpa038764_anti-alpp-pab-atl-hpa038764_46128__00543.1783635399.jpg?compression=lossy)


![Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: Human Placenta tissue](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/50594/35052/atl-hpa038764_anti-alpp-pab-atl-hpa038764_46128__00543.1783635399.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NWYSDADVPASARQEGCQDIATQLISNMDI |
| Gene Sequence | NWYSDADVPASARQEGCQDIATQLISNMDI |
| Gene ID - Mouse | ENSMUSG00000079440 |
| Gene ID - Rat | ENSRNOG00000058652 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ALPP pAb (ATL-HPA038764) | |
| Datasheet | Anti ALPP pAb (ATL-HPA038764) Datasheet (External Link) |
| Vendor Page | Anti ALPP pAb (ATL-HPA038764) at Atlas Antibodies |
| Documents & Links for Anti ALPP pAb (ATL-HPA038764) | |
| Datasheet | Anti ALPP pAb (ATL-HPA038764) Datasheet (External Link) |
| Vendor Page | Anti ALPP pAb (ATL-HPA038764) |
| Citations for Anti ALPP pAb (ATL-HPA038764) – 1 Found |
| Chen, Jian; Chen, Zhilu; Liu, Mingbin; Qiu, Tianyi; Feng, Daobin; Zhao, Chen; Zhang, Shuye; Zhang, Xiaoyan; Xu, Jianqing. Placental Alkaline Phosphatase Promotes Zika Virus Replication by Stabilizing Viral Proteins through BIP. Mbio. 2020;11(5) PubMed |


![Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: Human Placenta tissue](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/50594/35052/atl-hpa038764_anti-alpp-pab-atl-hpa038764_46128__00543.1783635399.jpg?compression=lossy)


![Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: Human Placenta tissue](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/50594/35052/atl-hpa038764_anti-alpp-pab-atl-hpa038764_46128__00543.1783635399.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NWYSDADVPASARQEGCQDIATQLISNMDI |
| Gene Sequence | NWYSDADVPASARQEGCQDIATQLISNMDI |
| Gene ID - Mouse | ENSMUSG00000079440 |
| Gene ID - Rat | ENSRNOG00000058652 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ALPP pAb (ATL-HPA038764) | |
| Datasheet | Anti ALPP pAb (ATL-HPA038764) Datasheet (External Link) |
| Vendor Page | Anti ALPP pAb (ATL-HPA038764) at Atlas Antibodies |
| Documents & Links for Anti ALPP pAb (ATL-HPA038764) | |
| Datasheet | Anti ALPP pAb (ATL-HPA038764) Datasheet (External Link) |
| Vendor Page | Anti ALPP pAb (ATL-HPA038764) |
| Citations for Anti ALPP pAb (ATL-HPA038764) – 1 Found |
| Chen, Jian; Chen, Zhilu; Liu, Mingbin; Qiu, Tianyi; Feng, Daobin; Zhao, Chen; Zhang, Shuye; Zhang, Xiaoyan; Xu, Jianqing. Placental Alkaline Phosphatase Promotes Zika Virus Replication by Stabilizing Viral Proteins through BIP. Mbio. 2020;11(5) PubMed |
No reviews have been added for this product.