Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AQVGERLMVHCDSKTGNANTDFIWVGPDNRLLEPDKEMENFYVFHNGSLVIESPRFEDAGVYSCIAMNKQRLLNETVDVTINVSNFTVSRS |
| Gene Sequence | AQVGERLMVHCDSKTGNANTDFIWVGPDNRLLEPDKEMENFYVFHNGSLVIESPRFEDAGVYSCIAMNKQRLLNETVDVTINVSNFTVSRS |
| Gene ID - Mouse | ENSMUSG00000048218 |
| Gene ID - Rat | ENSRNOG00000007032 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AMIGO2 pAb (ATL-HPA054004) | |
| Datasheet | Anti AMIGO2 pAb (ATL-HPA054004) Datasheet (External Link) |
| Vendor Page | Anti AMIGO2 pAb (ATL-HPA054004) at Atlas Antibodies |
| Documents & Links for Anti AMIGO2 pAb (ATL-HPA054004) | |
| Datasheet | Anti AMIGO2 pAb (ATL-HPA054004) Datasheet (External Link) |
| Vendor Page | Anti AMIGO2 pAb (ATL-HPA054004) |
| Citations for Anti AMIGO2 pAb (ATL-HPA054004) – 2 Found |
| Yi, Yuyin; Zhu, Hua; Klausen, Christian; Chang, Hsun-Ming; Inkster, Amy M; Terry, Jefferson; Leung, Peter C K. Dysregulated BMP2 in the Placenta May Contribute to Early-Onset Preeclampsia by Regulating Human Trophoblast Expression of Extracellular Matrix and Adhesion Molecules. Frontiers In Cell And Developmental Biology. 9( 34970543):768669. PubMed |
| Goto, Keisuke; Osaki, Mitsuhiko; Izutsu, Runa; Tanaka, Hiroshi; Sasaki, Ryo; Tanio, Akimitsu; Satofuka, Hiroyuki; Kazuki, Yasuhiro; Yamamoto, Manabu; Kugoh, Hiroyuki; Ito, Hisao; Oshimura, Mitsuo; Fujiwara, Yoshiyuki; Okada, Futoshi. Establishment of an antibody specific for AMIGO2 improves immunohistochemical evaluation of liver metastases and clinical outcomes in patients with colorectal cancer. Diagnostic Pathology. 2022;17(1):16. PubMed |
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AQVGERLMVHCDSKTGNANTDFIWVGPDNRLLEPDKEMENFYVFHNGSLVIESPRFEDAGVYSCIAMNKQRLLNETVDVTINVSNFTVSRS |
| Gene Sequence | AQVGERLMVHCDSKTGNANTDFIWVGPDNRLLEPDKEMENFYVFHNGSLVIESPRFEDAGVYSCIAMNKQRLLNETVDVTINVSNFTVSRS |
| Gene ID - Mouse | ENSMUSG00000048218 |
| Gene ID - Rat | ENSRNOG00000007032 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AMIGO2 pAb (ATL-HPA054004) | |
| Datasheet | Anti AMIGO2 pAb (ATL-HPA054004) Datasheet (External Link) |
| Vendor Page | Anti AMIGO2 pAb (ATL-HPA054004) at Atlas Antibodies |
| Documents & Links for Anti AMIGO2 pAb (ATL-HPA054004) | |
| Datasheet | Anti AMIGO2 pAb (ATL-HPA054004) Datasheet (External Link) |
| Vendor Page | Anti AMIGO2 pAb (ATL-HPA054004) |
| Citations for Anti AMIGO2 pAb (ATL-HPA054004) – 2 Found |
| Yi, Yuyin; Zhu, Hua; Klausen, Christian; Chang, Hsun-Ming; Inkster, Amy M; Terry, Jefferson; Leung, Peter C K. Dysregulated BMP2 in the Placenta May Contribute to Early-Onset Preeclampsia by Regulating Human Trophoblast Expression of Extracellular Matrix and Adhesion Molecules. Frontiers In Cell And Developmental Biology. 9( 34970543):768669. PubMed |
| Goto, Keisuke; Osaki, Mitsuhiko; Izutsu, Runa; Tanaka, Hiroshi; Sasaki, Ryo; Tanio, Akimitsu; Satofuka, Hiroyuki; Kazuki, Yasuhiro; Yamamoto, Manabu; Kugoh, Hiroyuki; Ito, Hisao; Oshimura, Mitsuo; Fujiwara, Yoshiyuki; Okada, Futoshi. Establishment of an antibody specific for AMIGO2 improves immunohistochemical evaluation of liver metastases and clinical outcomes in patients with colorectal cancer. Diagnostic Pathology. 2022;17(1):16. PubMed |