Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
Atlas Antibodies
Atlas Antibodies
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VSKLWVPNTDFDVAANWSQNRTPCAGGAVEFPADKMVSVLVQEGHAVSDMLLPLDGELVLASGAGFGVSDVGSHLDCGAGEPAVFRDSDRFSWHDPHLWRSGDEAPGLFFVDAERVPCRHDDVFFPPSASFRVGLGPGASPVRVRSISAL |
| Gene Sequence | VSKLWVPNTDFDVAANWSQNRTPCAGGAVEFPADKMVSVLVQEGHAVSDMLLPLDGELVLASGAGFGVSDVGSHLDCGAGEPAVFRDSDRFSWHDPHLWRSGDEAPGLFFVDAERVPCRHDDVFFPPSASFRVGLGPGASPVRVRSISAL |
| Gene ID - Mouse | ENSMUSG00000021278 |
| Gene ID - Rat | ENSRNOG00000009050 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AMN pAb (ATL-HPA000817) | |
| Datasheet | Anti AMN pAb (ATL-HPA000817) Datasheet (External Link) |
| Vendor Page | Anti AMN pAb (ATL-HPA000817) at Atlas Antibodies |
| Documents & Links for Anti AMN pAb (ATL-HPA000817) | |
| Datasheet | Anti AMN pAb (ATL-HPA000817) Datasheet (External Link) |
| Vendor Page | Anti AMN pAb (ATL-HPA000817) |
| Citations for Anti AMN pAb (ATL-HPA000817) – 2 Found |
| Udagawa, Tomohiro; Harita, Yutaka; Miura, Kenichiro; Mitsui, Jun; Ode, Koji L; Morishita, Shinichi; Urae, Seiya; Kanda, Shoichiro; Kajiho, Yuko; Tsurumi, Haruko; Ueda, Hiroki R; Tsuji, Shoji; Saito, Akihiko; Oka, Akira. Amnionless-mediated glycosylation is crucial for cell surface targeting of cubilin in renal and intestinal cells. Scientific Reports. 2018;8(1):2351. PubMed |
| Galamb, Orsolya; Sipos, Ferenc; Spisák, Sándor; Galamb, Barnabás; Krenács, Tibor; Valcz, Gábor; Tulassay, Zsolt; Molnár, Béla. Potential biomarkers of colorectal adenoma-dysplasia-carcinoma progression: mRNA expression profiling and in situ protein detection on TMAs reveal 15 sequentially upregulated and 2 downregulated genes. Cellular Oncology : The Official Journal Of The International Society For Cellular Oncology. 31(1):19-29. PubMed |
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VSKLWVPNTDFDVAANWSQNRTPCAGGAVEFPADKMVSVLVQEGHAVSDMLLPLDGELVLASGAGFGVSDVGSHLDCGAGEPAVFRDSDRFSWHDPHLWRSGDEAPGLFFVDAERVPCRHDDVFFPPSASFRVGLGPGASPVRVRSISAL |
| Gene Sequence | VSKLWVPNTDFDVAANWSQNRTPCAGGAVEFPADKMVSVLVQEGHAVSDMLLPLDGELVLASGAGFGVSDVGSHLDCGAGEPAVFRDSDRFSWHDPHLWRSGDEAPGLFFVDAERVPCRHDDVFFPPSASFRVGLGPGASPVRVRSISAL |
| Gene ID - Mouse | ENSMUSG00000021278 |
| Gene ID - Rat | ENSRNOG00000009050 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AMN pAb (ATL-HPA000817) | |
| Datasheet | Anti AMN pAb (ATL-HPA000817) Datasheet (External Link) |
| Vendor Page | Anti AMN pAb (ATL-HPA000817) at Atlas Antibodies |
| Documents & Links for Anti AMN pAb (ATL-HPA000817) | |
| Datasheet | Anti AMN pAb (ATL-HPA000817) Datasheet (External Link) |
| Vendor Page | Anti AMN pAb (ATL-HPA000817) |
| Citations for Anti AMN pAb (ATL-HPA000817) – 2 Found |
| Udagawa, Tomohiro; Harita, Yutaka; Miura, Kenichiro; Mitsui, Jun; Ode, Koji L; Morishita, Shinichi; Urae, Seiya; Kanda, Shoichiro; Kajiho, Yuko; Tsurumi, Haruko; Ueda, Hiroki R; Tsuji, Shoji; Saito, Akihiko; Oka, Akira. Amnionless-mediated glycosylation is crucial for cell surface targeting of cubilin in renal and intestinal cells. Scientific Reports. 2018;8(1):2351. PubMed |
| Galamb, Orsolya; Sipos, Ferenc; Spisák, Sándor; Galamb, Barnabás; Krenács, Tibor; Valcz, Gábor; Tulassay, Zsolt; Molnár, Béla. Potential biomarkers of colorectal adenoma-dysplasia-carcinoma progression: mRNA expression profiling and in situ protein detection on TMAs reveal 15 sequentially upregulated and 2 downregulated genes. Cellular Oncology : The Official Journal Of The International Society For Cellular Oncology. 31(1):19-29. PubMed |
No reviews have been added for this product.