Loading...
Loading...
Loading...
Loading...
No reviews have been added for this product.
Atlas Antibodies
![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/44935/24603/atl-hpa019829_anti-amph-pab-atl-hpa019829-wenhanced-validation_35379__90658.1783627832.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PGFLYKVETLHDFEAANSDELTLQRGDVVLVVPSDSEADQDAGWLVGVKESDWLQYRDLATYKGLFPENFTRRL |
| Gene Sequence | PGFLYKVETLHDFEAANSDELTLQRGDVVLVVPSDSEADQDAGWLVGVKESDWLQYRDLATYKGLFPENFTRRL |
| Gene ID - Mouse | ENSMUSG00000021314 |
| Gene ID - Rat | ENSRNOG00000059510 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AMPH pAb (ATL-HPA019829 w/enhanced validation) | |
| Datasheet | Anti AMPH pAb (ATL-HPA019829 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti AMPH pAb (ATL-HPA019829 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti AMPH pAb (ATL-HPA019829 w/enhanced validation) | |
| Datasheet | Anti AMPH pAb (ATL-HPA019829 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti AMPH pAb (ATL-HPA019829 w/enhanced validation) |
| Citations for Anti AMPH pAb (ATL-HPA019829 w/enhanced validation) – 3 Found |
| Bedri, Sahl Khalid; Nilsson, Ola B; Fink, Katharina; Månberg, Anna; Hamsten, Carl; Ayoglu, Burcu; Manouchehrinia, Ali; Nilsson, Peter; Olsson, Tomas; Hillert, Jan; Grönlund, Hans; Glaser, Anna. Plasma protein profiling reveals candidate biomarkers for multiple sclerosis treatment. Plos One. 14(5):e0217208. PubMed |
| Bergström, Sofia; Remnestål, Julia; Yousef, Jamil; Olofsson, Jennie; Markaki, Ioanna; Carvalho, Stephanie; Corvol, Jean-Christophe; Kultima, Kim; Kilander, Lena; Löwenmark, Malin; Ingelsson, Martin; Blennow, Kaj; Zetterberg, Henrik; Nellgård, Bengt; Brosseron, Frederic; Heneka, Michael T; Bosch, Beatriz; Sanchez-Valle, Raquel; Månberg, Anna; Svenningsson, Per; Nilsson, Peter. Multi-cohort profiling reveals elevated CSF levels of brain-enriched proteins in Alzheimer's disease. Annals Of Clinical And Translational Neurology. 2021;8(7):1456-1470. PubMed |
| Bergström, Sofia; Öijerstedt, Linn; Remnestål, Julia; Olofsson, Jennie; Ullgren, Abbe; Seelaar, Harro; van Swieten, John C; Synofzik, Matthis; Sanchez-Valle, Raquel; Moreno, Fermin; Finger, Elizabeth; Masellis, Mario; Tartaglia, Carmela; Vandenberghe, Rik; Laforce, Robert; Galimberti, Daniela; Borroni, Barbara; Butler, Chris R; Gerhard, Alexander; Ducharme, Simon; Rohrer, Jonathan D; Månberg, Anna; Graff, Caroline; Nilsson, Peter. A panel of CSF proteins separates genetic frontotemporal dementia from presymptomatic mutation carriers: a GENFI study. Molecular Neurodegeneration. 2021;16(1):79. PubMed |
Try browsing our complete catalog of products.
Atlas Antibodies
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PGFLYKVETLHDFEAANSDELTLQRGDVVLVVPSDSEADQDAGWLVGVKESDWLQYRDLATYKGLFPENFTRRL |
| Gene Sequence | PGFLYKVETLHDFEAANSDELTLQRGDVVLVVPSDSEADQDAGWLVGVKESDWLQYRDLATYKGLFPENFTRRL |
| Gene ID - Mouse | ENSMUSG00000021314 |
| Gene ID - Rat | ENSRNOG00000059510 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AMPH pAb (ATL-HPA019829 w/enhanced validation) | |
| Datasheet | Anti AMPH pAb (ATL-HPA019829 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti AMPH pAb (ATL-HPA019829 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti AMPH pAb (ATL-HPA019829 w/enhanced validation) | |
| Datasheet | Anti AMPH pAb (ATL-HPA019829 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti AMPH pAb (ATL-HPA019829 w/enhanced validation) |
| Citations for Anti AMPH pAb (ATL-HPA019829 w/enhanced validation) – 3 Found |
| Bedri, Sahl Khalid; Nilsson, Ola B; Fink, Katharina; Månberg, Anna; Hamsten, Carl; Ayoglu, Burcu; Manouchehrinia, Ali; Nilsson, Peter; Olsson, Tomas; Hillert, Jan; Grönlund, Hans; Glaser, Anna. Plasma protein profiling reveals candidate biomarkers for multiple sclerosis treatment. Plos One. 14(5):e0217208. PubMed |
| Bergström, Sofia; Remnestål, Julia; Yousef, Jamil; Olofsson, Jennie; Markaki, Ioanna; Carvalho, Stephanie; Corvol, Jean-Christophe; Kultima, Kim; Kilander, Lena; Löwenmark, Malin; Ingelsson, Martin; Blennow, Kaj; Zetterberg, Henrik; Nellgård, Bengt; Brosseron, Frederic; Heneka, Michael T; Bosch, Beatriz; Sanchez-Valle, Raquel; Månberg, Anna; Svenningsson, Per; Nilsson, Peter. Multi-cohort profiling reveals elevated CSF levels of brain-enriched proteins in Alzheimer's disease. Annals Of Clinical And Translational Neurology. 2021;8(7):1456-1470. PubMed |
| Bergström, Sofia; Öijerstedt, Linn; Remnestål, Julia; Olofsson, Jennie; Ullgren, Abbe; Seelaar, Harro; van Swieten, John C; Synofzik, Matthis; Sanchez-Valle, Raquel; Moreno, Fermin; Finger, Elizabeth; Masellis, Mario; Tartaglia, Carmela; Vandenberghe, Rik; Laforce, Robert; Galimberti, Daniela; Borroni, Barbara; Butler, Chris R; Gerhard, Alexander; Ducharme, Simon; Rohrer, Jonathan D; Månberg, Anna; Graff, Caroline; Nilsson, Peter. A panel of CSF proteins separates genetic frontotemporal dementia from presymptomatic mutation carriers: a GENFI study. Molecular Neurodegeneration. 2021;16(1):79. PubMed |