Loading...
Loading...
Loading...
Loading...
No reviews have been added for this product.
Atlas Antibodies
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL |
| Gene Sequence | SLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL |
| Gene ID - Mouse | ENSMUSG00000074264 |
| Gene ID - Rat | ENSRNOG00000055613 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AMY1A pAb (ATL-HPA045394) | |
| Datasheet | Anti AMY1A pAb (ATL-HPA045394) Datasheet (External Link) |
| Vendor Page | Anti AMY1A pAb (ATL-HPA045394) at Atlas Antibodies |
| Documents & Links for Anti AMY1A pAb (ATL-HPA045394) | |
| Datasheet | Anti AMY1A pAb (ATL-HPA045394) Datasheet (External Link) |
| Vendor Page | Anti AMY1A pAb (ATL-HPA045394) |
| Citations for Anti AMY1A pAb (ATL-HPA045394) – 2 Found |
| Granlund, Louise; Hedin, Anders; Wahlhütter, Miriam; Seiron, Peter; Korsgren, Olle; Skog, Oskar; Lundberg, Marcus. Histological and transcriptional characterization of the pancreatic acinar tissue in type 1 diabetes. Bmj Open Diabetes Research & Care. 2021;9(1) PubMed |
| Saitou, Marie; Gaylord, Eliza A; Xu, Erica; May, Alison J; Neznanova, Lubov; Nathan, Sara; Grawe, Anissa; Chang, Jolie; Ryan, William; Ruhl, Stefan; Knox, Sarah M; Gokcumen, Omer. Functional Specialization of Human Salivary Glands and Origins of Proteins Intrinsic to Human Saliva. Cell Reports. 2020;33(7):108402. PubMed |
Try browsing our complete catalog of products.
Atlas Antibodies
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL |
| Gene Sequence | SLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL |
| Gene ID - Mouse | ENSMUSG00000074264 |
| Gene ID - Rat | ENSRNOG00000055613 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AMY1A pAb (ATL-HPA045394) | |
| Datasheet | Anti AMY1A pAb (ATL-HPA045394) Datasheet (External Link) |
| Vendor Page | Anti AMY1A pAb (ATL-HPA045394) at Atlas Antibodies |
| Documents & Links for Anti AMY1A pAb (ATL-HPA045394) | |
| Datasheet | Anti AMY1A pAb (ATL-HPA045394) Datasheet (External Link) |
| Vendor Page | Anti AMY1A pAb (ATL-HPA045394) |
| Citations for Anti AMY1A pAb (ATL-HPA045394) – 2 Found |
| Granlund, Louise; Hedin, Anders; Wahlhütter, Miriam; Seiron, Peter; Korsgren, Olle; Skog, Oskar; Lundberg, Marcus. Histological and transcriptional characterization of the pancreatic acinar tissue in type 1 diabetes. Bmj Open Diabetes Research & Care. 2021;9(1) PubMed |
| Saitou, Marie; Gaylord, Eliza A; Xu, Erica; May, Alison J; Neznanova, Lubov; Nathan, Sara; Grawe, Anissa; Chang, Jolie; Ryan, William; Ruhl, Stefan; Knox, Sarah M; Gokcumen, Omer. Functional Specialization of Human Salivary Glands and Origins of Proteins Intrinsic to Human Saliva. Cell Reports. 2020;33(7):108402. PubMed |