Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/57367/46143/atl-hpa056953_anti-ank1-pab-atl-hpa056953_57627__52370.1783642942.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FVLVSDKHRMSFPETVDEILDVSEDEGEELISFKAERRDSRDVDEEKELLDFVPKLDQVVESPAIPRIPCAMPETVVIRSEEQEQASKEYDEDSLIPSSP |
| Gene Sequence | FVLVSDKHRMSFPETVDEILDVSEDEGEELISFKAERRDSRDVDEEKELLDFVPKLDQVVESPAIPRIPCAMPETVVIRSEEQEQASKEYDEDSLIPSSP |
| Gene ID - Mouse | ENSMUSG00000031543 |
| Gene ID - Rat | ENSRNOG00000018241 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ANK1 pAb (ATL-HPA056953) | |
| Datasheet | Anti ANK1 pAb (ATL-HPA056953) Datasheet (External Link) |
| Vendor Page | Anti ANK1 pAb (ATL-HPA056953) at Atlas Antibodies |
| Documents & Links for Anti ANK1 pAb (ATL-HPA056953) | |
| Datasheet | Anti ANK1 pAb (ATL-HPA056953) Datasheet (External Link) |
| Vendor Page | Anti ANK1 pAb (ATL-HPA056953) |
| Citations for Anti ANK1 pAb (ATL-HPA056953) – 1 Found |
| Hall, A E; Lu, W-T; Godfrey, J D; Antonov, A V; Paicu, C; Moxon, S; Dalmay, T; Wilczynska, A; Muller, P A J; Bushell, M. The cytoskeleton adaptor protein ankyrin-1 is upregulated by p53 following DNA damage and alters cell migration. Cell Death & Disease. 2016;7(4):e2184. PubMed |
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FVLVSDKHRMSFPETVDEILDVSEDEGEELISFKAERRDSRDVDEEKELLDFVPKLDQVVESPAIPRIPCAMPETVVIRSEEQEQASKEYDEDSLIPSSP |
| Gene Sequence | FVLVSDKHRMSFPETVDEILDVSEDEGEELISFKAERRDSRDVDEEKELLDFVPKLDQVVESPAIPRIPCAMPETVVIRSEEQEQASKEYDEDSLIPSSP |
| Gene ID - Mouse | ENSMUSG00000031543 |
| Gene ID - Rat | ENSRNOG00000018241 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ANK1 pAb (ATL-HPA056953) | |
| Datasheet | Anti ANK1 pAb (ATL-HPA056953) Datasheet (External Link) |
| Vendor Page | Anti ANK1 pAb (ATL-HPA056953) at Atlas Antibodies |
| Documents & Links for Anti ANK1 pAb (ATL-HPA056953) | |
| Datasheet | Anti ANK1 pAb (ATL-HPA056953) Datasheet (External Link) |
| Vendor Page | Anti ANK1 pAb (ATL-HPA056953) |
| Citations for Anti ANK1 pAb (ATL-HPA056953) – 1 Found |
| Hall, A E; Lu, W-T; Godfrey, J D; Antonov, A V; Paicu, C; Moxon, S; Dalmay, T; Wilczynska, A; Muller, P A J; Bushell, M. The cytoskeleton adaptor protein ankyrin-1 is upregulated by p53 following DNA damage and alters cell migration. Cell Death & Disease. 2016;7(4):e2184. PubMed |