Related products

Reviews 0

No reviews have been added for this product.

Reviews

Protein Description: ankyrin repeat and KH domain containing 1
Gene Name: ANKHD1
Alternative Gene Name: FLJ10042, FLJ11979, FLJ14127, FLJ20288, KIAA1085, MASK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024483: 87%, ENSRNOG00000030247: 83%
Entrez Gene ID: 54882
Uniprot ID: Q8IWZ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application	IHC
Reactivity	Human
Clonality	Polyclonal
Host	Rabbit
Immunogen	QKVERQLQMKTQQQFTKEYLETKGQKDTVSLHQQCSHRGVFPEGEGDGSLPEDHFSELPQVDTILFKDNDVDDEQQSPPSAEQIDFVPVQPLSSPQCNFSSDLGSNGTNSLELQKVSGNQQIVGQPQIAITGHDQGLLVQEPD
Gene Sequence	QKVERQLQMKTQQQFTKEYLETKGQKDTVSLHQQCSHRGVFPEGEGDGSLPEDHFSELPQVDTILFKDNDVDDEQQSPPSAEQIDFVPVQPLSSPQCNFSSDLGSNGTNSLELQKVSGNQQIVGQPQIAITGHDQGLLVQEPD
Gene ID - Mouse	ENSMUSG00000024483
Gene ID - Rat	ENSRNOG00000030247
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ANKHD1 pAb (ATL-HPA008718)
Datasheet	Anti ANKHD1 pAb (ATL-HPA008718) Datasheet (External Link)
Vendor Page	Anti ANKHD1 pAb (ATL-HPA008718) at Atlas Antibodies

Documents & Links for Anti ANKHD1 pAb (ATL-HPA008718)
Datasheet	Anti ANKHD1 pAb (ATL-HPA008718) Datasheet (External Link)
Vendor Page	Anti ANKHD1 pAb (ATL-HPA008718)

Citations for Anti ANKHD1 pAb (ATL-HPA008718) – 2 Found

Fragiadaki, Maria; Zeidler, Martin P. Ankyrin repeat and single KH domain 1 (ANKHD1) drives renal cancer cell proliferation via binding to and altering a subset of miRNAs. The Journal Of Biological Chemistry. 2018;293(25):9570-9579. PubMed

Fisher, Katherine H; Fragiadaki, Maria; Pugazhendhi, Dhamayanthi; Bausek, Nina; Arredondo, Maria A; Thomas, Sally J; Brown, Stephen; Zeidler, Martin P. A genome-wide RNAi screen identifies MASK as a positive regulator of cytokine receptor stability. Journal Of Cell Science. 2018;131(13) PubMed

Reviews 0

Reviews

Anti ANKHD1 pAb (ATL-HPA008718)

Additional information

Anti ANKHD1 pAb (ATL-HPA008718)

Additional information

Specifications

Reviews 0

Anti ANKHD1 pAb (ATL-HPA008718)

Additional information

Specifications

Anti ANKHD1 pAb (ATL-HPA008718)

Additional information

Specifications

Specifications

No related products found