Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies

![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/58671/47948/atl-hpa061649_anti-ankrd55-pab-atl-hpa061649_59502__10256.1783644155.jpg?compression=lossy)

![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/58671/47948/atl-hpa061649_anti-ankrd55-pab-atl-hpa061649_59502__10256.1783644155.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RQATMDFSTPSVFDQQRGDSSEEVDLTMVYQAASNGDVNALTAVIREDPSILECCDSEGCTPLMHAVSGRQADTVKLLLKMGAN |
| Gene Sequence | RQATMDFSTPSVFDQQRGDSSEEVDLTMVYQAASNGDVNALTAVIREDPSILECCDSEGCTPLMHAVSGRQADTVKLLLKMGAN |
| Gene ID - Mouse | ENSMUSG00000049985 |
| Gene ID - Rat | ENSRNOG00000013555 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ANKRD55 pAb (ATL-HPA061649) | |
| Datasheet | Anti ANKRD55 pAb (ATL-HPA061649) Datasheet (External Link) |
| Vendor Page | Anti ANKRD55 pAb (ATL-HPA061649) at Atlas Antibodies |
| Documents & Links for Anti ANKRD55 pAb (ATL-HPA061649) | |
| Datasheet | Anti ANKRD55 pAb (ATL-HPA061649) Datasheet (External Link) |
| Vendor Page | Anti ANKRD55 pAb (ATL-HPA061649) |
| Citations for Anti ANKRD55 pAb (ATL-HPA061649) – 1 Found |
| Mena, Jorge; Alloza, Iraide; Tulloch Navarro, Raquel; Aldekoa, Ane; Díez García, Javier; Villanueva Etxebarria, Ane; Lindskog, Cecilia; Antigüedad, Alfredo; Boyero, Sabas; Mendibe-Bilbao, María Del Mar; Álvarez de Arcaya, Amaya; Sánchez Menoyo, José Luis; Midaglia, Luciana; Villarrubia, Noelia; Malhotra, Sunny; Montalban, Xavier; Villar, Luisa María; Comabella, Manuel; Vandenbroeck, Koen. Genomic Multiple Sclerosis Risk Variants Modulate the Expression of the ANKRD55-IL6ST Gene Region in Immature Dendritic Cells. Frontiers In Immunology. 12( 35111166):816930. PubMed |

![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/58671/47948/atl-hpa061649_anti-ankrd55-pab-atl-hpa061649_59502__10256.1783644155.jpg?compression=lossy)

![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/58671/47948/atl-hpa061649_anti-ankrd55-pab-atl-hpa061649_59502__10256.1783644155.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RQATMDFSTPSVFDQQRGDSSEEVDLTMVYQAASNGDVNALTAVIREDPSILECCDSEGCTPLMHAVSGRQADTVKLLLKMGAN |
| Gene Sequence | RQATMDFSTPSVFDQQRGDSSEEVDLTMVYQAASNGDVNALTAVIREDPSILECCDSEGCTPLMHAVSGRQADTVKLLLKMGAN |
| Gene ID - Mouse | ENSMUSG00000049985 |
| Gene ID - Rat | ENSRNOG00000013555 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ANKRD55 pAb (ATL-HPA061649) | |
| Datasheet | Anti ANKRD55 pAb (ATL-HPA061649) Datasheet (External Link) |
| Vendor Page | Anti ANKRD55 pAb (ATL-HPA061649) at Atlas Antibodies |
| Documents & Links for Anti ANKRD55 pAb (ATL-HPA061649) | |
| Datasheet | Anti ANKRD55 pAb (ATL-HPA061649) Datasheet (External Link) |
| Vendor Page | Anti ANKRD55 pAb (ATL-HPA061649) |
| Citations for Anti ANKRD55 pAb (ATL-HPA061649) – 1 Found |
| Mena, Jorge; Alloza, Iraide; Tulloch Navarro, Raquel; Aldekoa, Ane; Díez García, Javier; Villanueva Etxebarria, Ane; Lindskog, Cecilia; Antigüedad, Alfredo; Boyero, Sabas; Mendibe-Bilbao, María Del Mar; Álvarez de Arcaya, Amaya; Sánchez Menoyo, José Luis; Midaglia, Luciana; Villarrubia, Noelia; Malhotra, Sunny; Montalban, Xavier; Villar, Luisa María; Comabella, Manuel; Vandenbroeck, Koen. Genomic Multiple Sclerosis Risk Variants Modulate the Expression of the ANKRD55-IL6ST Gene Region in Immature Dendritic Cells. Frontiers In Immunology. 12( 35111166):816930. PubMed |