Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies
![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/49002/32156/atl-hpa035208_anti-ankzf1-pab-atl-hpa035208_43152__87286.1783633329.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YEEDPREAVRLHSPQTHWKTVREERKKPTEEEIRKICRDEKEALGQNEESPKQGSGSEGEDGFQVELELVELTVGTLDLCESEVLPKR |
| Gene Sequence | YEEDPREAVRLHSPQTHWKTVREERKKPTEEEIRKICRDEKEALGQNEESPKQGSGSEGEDGFQVELELVELTVGTLDLCESEVLPKR |
| Gene ID - Mouse | ENSMUSG00000026199 |
| Gene ID - Rat | ENSRNOG00000019052 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ANKZF1 pAb (ATL-HPA035208) | |
| Datasheet | Anti ANKZF1 pAb (ATL-HPA035208) Datasheet (External Link) |
| Vendor Page | Anti ANKZF1 pAb (ATL-HPA035208) at Atlas Antibodies |
| Documents & Links for Anti ANKZF1 pAb (ATL-HPA035208) | |
| Datasheet | Anti ANKZF1 pAb (ATL-HPA035208) Datasheet (External Link) |
| Vendor Page | Anti ANKZF1 pAb (ATL-HPA035208) |
| Citations for Anti ANKZF1 pAb (ATL-HPA035208) – 1 Found |
| van Haaften-Visser, Désirée Y; Harakalova, Magdalena; Mocholi, Enric; van Montfrans, Joris M; Elkadri, Abdul; Rieter, Ester; Fiedler, Karoline; van Hasselt, Peter M; Triffaux, Emily M M; van Haelst, Mieke M; Nijman, Isaac J; Kloosterman, Wigard P; Nieuwenhuis, Edward E S; Muise, Aleixo M; Cuppen, Edwin; Houwen, Roderick H J; Coffer, Paul J. Ankyrin repeat and zinc-finger domain-containing 1 mutations are associated with infantile-onset inflammatory bowel disease. The Journal Of Biological Chemistry. 2017;292(19):7904-7920. PubMed |
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YEEDPREAVRLHSPQTHWKTVREERKKPTEEEIRKICRDEKEALGQNEESPKQGSGSEGEDGFQVELELVELTVGTLDLCESEVLPKR |
| Gene Sequence | YEEDPREAVRLHSPQTHWKTVREERKKPTEEEIRKICRDEKEALGQNEESPKQGSGSEGEDGFQVELELVELTVGTLDLCESEVLPKR |
| Gene ID - Mouse | ENSMUSG00000026199 |
| Gene ID - Rat | ENSRNOG00000019052 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ANKZF1 pAb (ATL-HPA035208) | |
| Datasheet | Anti ANKZF1 pAb (ATL-HPA035208) Datasheet (External Link) |
| Vendor Page | Anti ANKZF1 pAb (ATL-HPA035208) at Atlas Antibodies |
| Documents & Links for Anti ANKZF1 pAb (ATL-HPA035208) | |
| Datasheet | Anti ANKZF1 pAb (ATL-HPA035208) Datasheet (External Link) |
| Vendor Page | Anti ANKZF1 pAb (ATL-HPA035208) |
| Citations for Anti ANKZF1 pAb (ATL-HPA035208) – 1 Found |
| van Haaften-Visser, Désirée Y; Harakalova, Magdalena; Mocholi, Enric; van Montfrans, Joris M; Elkadri, Abdul; Rieter, Ester; Fiedler, Karoline; van Hasselt, Peter M; Triffaux, Emily M M; van Haelst, Mieke M; Nijman, Isaac J; Kloosterman, Wigard P; Nieuwenhuis, Edward E S; Muise, Aleixo M; Cuppen, Edwin; Houwen, Roderick H J; Coffer, Paul J. Ankyrin repeat and zinc-finger domain-containing 1 mutations are associated with infantile-onset inflammatory bowel disease. The Journal Of Biological Chemistry. 2017;292(19):7904-7920. PubMed |