Related products

No related products found

Try browsing our complete catalog of products.

Reviews 0

No reviews have been added for this product.

Reviews

Protein Description: anoctamin 8
Gene Name: ANO8
Alternative Gene Name: KIAA1623, TMEM16H
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034863: 53%, ENSRNOG00000052236: 27%
Entrez Gene ID: 57719
Uniprot ID: Q9HCE9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application	IHC
Reactivity	Human
Clonality	Polyclonal
Host	Rabbit
Immunogen	REHDSGGREEARAEGSGLDPATSSEKASAKAKGSTAGGHGPERPKRPGSLLAPNNVMKLKQIIPLQGKFLSSGAT
Gene Sequence	REHDSGGREEARAEGSGLDPATSSEKASAKAKGSTAGGHGPERPKRPGSLLAPNNVMKLKQIIPLQGKFLSSGAT
Gene ID - Mouse	ENSMUSG00000034863
Gene ID - Rat	ENSRNOG00000052236
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ANO8 pAb (ATL-HPA049206)
Datasheet	Anti ANO8 pAb (ATL-HPA049206) Datasheet (External Link)
Vendor Page	Anti ANO8 pAb (ATL-HPA049206) at Atlas Antibodies

Documents & Links for Anti ANO8 pAb (ATL-HPA049206)
Datasheet	Anti ANO8 pAb (ATL-HPA049206) Datasheet (External Link)
Vendor Page	Anti ANO8 pAb (ATL-HPA049206)

Citations for Anti ANO8 pAb (ATL-HPA049206) – 1 Found

Klee, Katharina M C; Hess, Michael W; Lohmüller, Michael; Herzog, Sebastian; Pfaller, Kristian; Müller, Thomas; Vogel, Georg F; Huber, Lukas A. A CRISPR screen in intestinal epithelial cells identifies novel factors for polarity and apical transport. Elife. 2023;12( 36661306) PubMed

No related products found

Reviews 0

Reviews

Anti ANO8 pAb (ATL-HPA049206)

Additional information

Anti ANO8 pAb (ATL-HPA049206)

Additional information

Specifications

No related products found

Reviews 0

Anti ANO8 pAb (ATL-HPA049206)

Additional information

Specifications

Anti ANO8 pAb (ATL-HPA049206)

Additional information

Specifications

Specifications