Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies




| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PPLYDAHELWHAMKGVGTDENCLIEILASRTNGEIFQMREAYCLQYSNNLQEDIYSETSGHFRDTLMNLVQGTREEGYTDPAMAAQDAMVLWEACQQKTGEHKTMLQMILCNK |
| Gene Sequence | PPLYDAHELWHAMKGVGTDENCLIEILASRTNGEIFQMREAYCLQYSNNLQEDIYSETSGHFRDTLMNLVQGTREEGYTDPAMAAQDAMVLWEACQQKTGEHKTMLQMILCNK |
| Gene ID - Mouse | ENSMUSG00000031635 |
| Gene ID - Rat | ENSRNOG00000014339 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ANXA10 pAb (ATL-HPA005469 w/enhanced validation) | |
| Datasheet | Anti ANXA10 pAb (ATL-HPA005469 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ANXA10 pAb (ATL-HPA005469 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ANXA10 pAb (ATL-HPA005469 w/enhanced validation) | |
| Datasheet | Anti ANXA10 pAb (ATL-HPA005469 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ANXA10 pAb (ATL-HPA005469 w/enhanced validation) |
| Citations for Anti ANXA10 pAb (ATL-HPA005469 w/enhanced validation) – 2 Found |
| Seidlitz, Therese; Chen, Yi-Ting; Uhlemann, Heike; Schölch, Sebastian; Kochall, Susan; Merker, Sebastian R; Klimova, Anna; Hennig, Alexander; Schweitzer, Christine; Pape, Kristin; Baretton, Gustavo B; Welsch, Thilo; Aust, Daniela E; Weitz, Jürgen; Koo, Bon-Kyoung; Stange, Daniel E. Mouse Models of Human Gastric Cancer Subtypes With Stomach-Specific CreERT2-Mediated Pathway Alterations. Gastroenterology. 2019;157(6):1599-1614.e2. PubMed |
| Balic, Adam; Chintoan-Uta, Cosmin; Vohra, Prerna; Sutton, Kate M; Cassady-Cain, Robin L; Hu, Tuan; Donaldson, David S; Stevens, Mark P; Mabbott, Neil A; Hume, David A; Sang, Helen M; Vervelde, Lonneke. Antigen Sampling CSF1R-Expressing Epithelial Cells Are the Functional Equivalents of Mammalian M Cells in the Avian Follicle-Associated Epithelium. Frontiers In Immunology. 10( 31695701):2495. PubMed |




| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PPLYDAHELWHAMKGVGTDENCLIEILASRTNGEIFQMREAYCLQYSNNLQEDIYSETSGHFRDTLMNLVQGTREEGYTDPAMAAQDAMVLWEACQQKTGEHKTMLQMILCNK |
| Gene Sequence | PPLYDAHELWHAMKGVGTDENCLIEILASRTNGEIFQMREAYCLQYSNNLQEDIYSETSGHFRDTLMNLVQGTREEGYTDPAMAAQDAMVLWEACQQKTGEHKTMLQMILCNK |
| Gene ID - Mouse | ENSMUSG00000031635 |
| Gene ID - Rat | ENSRNOG00000014339 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ANXA10 pAb (ATL-HPA005469 w/enhanced validation) | |
| Datasheet | Anti ANXA10 pAb (ATL-HPA005469 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ANXA10 pAb (ATL-HPA005469 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ANXA10 pAb (ATL-HPA005469 w/enhanced validation) | |
| Datasheet | Anti ANXA10 pAb (ATL-HPA005469 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ANXA10 pAb (ATL-HPA005469 w/enhanced validation) |
| Citations for Anti ANXA10 pAb (ATL-HPA005469 w/enhanced validation) – 2 Found |
| Seidlitz, Therese; Chen, Yi-Ting; Uhlemann, Heike; Schölch, Sebastian; Kochall, Susan; Merker, Sebastian R; Klimova, Anna; Hennig, Alexander; Schweitzer, Christine; Pape, Kristin; Baretton, Gustavo B; Welsch, Thilo; Aust, Daniela E; Weitz, Jürgen; Koo, Bon-Kyoung; Stange, Daniel E. Mouse Models of Human Gastric Cancer Subtypes With Stomach-Specific CreERT2-Mediated Pathway Alterations. Gastroenterology. 2019;157(6):1599-1614.e2. PubMed |
| Balic, Adam; Chintoan-Uta, Cosmin; Vohra, Prerna; Sutton, Kate M; Cassady-Cain, Robin L; Hu, Tuan; Donaldson, David S; Stevens, Mark P; Mabbott, Neil A; Hume, David A; Sang, Helen M; Vervelde, Lonneke. Antigen Sampling CSF1R-Expressing Epithelial Cells Are the Functional Equivalents of Mammalian M Cells in the Avian Follicle-Associated Epithelium. Frontiers In Immunology. 10( 31695701):2495. PubMed |