Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies




| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PYVAQEIQEEIDELLQEQRADMDQFTASISETPVDVRVSSEESEEIPPFHPFHPFPALPENEDTQPELYHPMK |
| Gene Sequence | PYVAQEIQEEIDELLQEQRADMDQFTASISETPVDVRVSSEESEEIPPFHPFHPFPALPENEDTQPELYHPMK |
| Gene ID - Mouse | ENSMUSG00000031996 |
| Gene ID - Rat | ENSRNOG00000047179 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti APLP2 pAb (ATL-HPA039319) | |
| Datasheet | Anti APLP2 pAb (ATL-HPA039319) Datasheet (External Link) |
| Vendor Page | Anti APLP2 pAb (ATL-HPA039319) at Atlas Antibodies |
| Documents & Links for Anti APLP2 pAb (ATL-HPA039319) | |
| Datasheet | Anti APLP2 pAb (ATL-HPA039319) Datasheet (External Link) |
| Vendor Page | Anti APLP2 pAb (ATL-HPA039319) |
| Citations for Anti APLP2 pAb (ATL-HPA039319) – 2 Found |
| Jackson, Travis C; Du, Lina; Janesko-Feldman, Keri; Vagni, Vincent A; Dezfulian, Cameron; Poloyac, Samuel M; Jackson, Edwin K; Clark, Robert S B; Kochanek, Patrick M. The nuclear splicing factor RNA binding motif 5 promotes caspase activation in human neuronal cells, and increases after traumatic brain injury in mice. Journal Of Cerebral Blood Flow And Metabolism : Official Journal Of The International Society Of Cerebral Blood Flow And Metabolism. 2015;35(4):655-66. PubMed |
| Long, Nguyen Phuoc; Jung, Kyung Hee; Anh, Nguyen Hoang; Yan, Hong Hua; Nghi, Tran Diem; Park, Seongoh; Yoon, Sang Jun; Min, Jung Eun; Kim, Hyung Min; Lim, Joo Han; Kim, Joon Mee; Lim, Johan; Lee, Sanghyuk; Hong, Soon-Sun; Kwon, Sung Won. An Integrative Data Mining and Omics-Based Translational Model for the Identification and Validation of Oncogenic Biomarkers of Pancreatic Cancer. Cancers. 2019;11(2) PubMed |




| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PYVAQEIQEEIDELLQEQRADMDQFTASISETPVDVRVSSEESEEIPPFHPFHPFPALPENEDTQPELYHPMK |
| Gene Sequence | PYVAQEIQEEIDELLQEQRADMDQFTASISETPVDVRVSSEESEEIPPFHPFHPFPALPENEDTQPELYHPMK |
| Gene ID - Mouse | ENSMUSG00000031996 |
| Gene ID - Rat | ENSRNOG00000047179 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti APLP2 pAb (ATL-HPA039319) | |
| Datasheet | Anti APLP2 pAb (ATL-HPA039319) Datasheet (External Link) |
| Vendor Page | Anti APLP2 pAb (ATL-HPA039319) at Atlas Antibodies |
| Documents & Links for Anti APLP2 pAb (ATL-HPA039319) | |
| Datasheet | Anti APLP2 pAb (ATL-HPA039319) Datasheet (External Link) |
| Vendor Page | Anti APLP2 pAb (ATL-HPA039319) |
| Citations for Anti APLP2 pAb (ATL-HPA039319) – 2 Found |
| Jackson, Travis C; Du, Lina; Janesko-Feldman, Keri; Vagni, Vincent A; Dezfulian, Cameron; Poloyac, Samuel M; Jackson, Edwin K; Clark, Robert S B; Kochanek, Patrick M. The nuclear splicing factor RNA binding motif 5 promotes caspase activation in human neuronal cells, and increases after traumatic brain injury in mice. Journal Of Cerebral Blood Flow And Metabolism : Official Journal Of The International Society Of Cerebral Blood Flow And Metabolism. 2015;35(4):655-66. PubMed |
| Long, Nguyen Phuoc; Jung, Kyung Hee; Anh, Nguyen Hoang; Yan, Hong Hua; Nghi, Tran Diem; Park, Seongoh; Yoon, Sang Jun; Min, Jung Eun; Kim, Hyung Min; Lim, Joo Han; Kim, Joon Mee; Lim, Johan; Lee, Sanghyuk; Hong, Soon-Sun; Kwon, Sung Won. An Integrative Data Mining and Omics-Based Translational Model for the Identification and Validation of Oncogenic Biomarkers of Pancreatic Cancer. Cancers. 2019;11(2) PubMed |