Loading...
Loading...
Loading...
Loading...
Try browsing our complete catalog of products.
No reviews have been added for this product.
Atlas Antibodies
Atlas Antibodies

![Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18<br/>Lane 2: Human cell line RT-4](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/41405/17871/atl-hpa002549_anti-apoa4-pab-atl-hpa002549-wenhanced-validation_28473__83784.1783622783.jpg?compression=lossy)

![Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18<br/>Lane 2: Human cell line RT-4](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/41405/17871/atl-hpa002549_anti-apoa4-pab-atl-hpa002549-wenhanced-validation_28473__83784.1783622783.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DKLGEVNTYAGDLQKKLVPFATELHERLAKDSEKLKEEIGKELEELRARLLPHANEVSQKIGDNLRELQQRLEPYADQLRTQVNTQAEQLRRQLTPYAQRMERVLRENADSLQASLRPHADELKAKIDQNVEELKGRLTPYADEFKVK |
| Gene Sequence | DKLGEVNTYAGDLQKKLVPFATELHERLAKDSEKLKEEIGKELEELRARLLPHANEVSQKIGDNLRELQQRLEPYADQLRTQVNTQAEQLRRQLTPYAQRMERVLRENADSLQASLRPHADELKAKIDQNVEELKGRLTPYADEFKVK |
| Gene ID - Mouse | ENSMUSG00000032080 |
| Gene ID - Rat | ENSRNOG00000055909 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti APOA4 pAb (ATL-HPA002549 w/enhanced validation) | |
| Datasheet | Anti APOA4 pAb (ATL-HPA002549 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti APOA4 pAb (ATL-HPA002549 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti APOA4 pAb (ATL-HPA002549 w/enhanced validation) | |
| Datasheet | Anti APOA4 pAb (ATL-HPA002549 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti APOA4 pAb (ATL-HPA002549 w/enhanced validation) |
| Citations for Anti APOA4 pAb (ATL-HPA002549 w/enhanced validation) – 2 Found |
| Kato, Bernet S; Nicholson, George; Neiman, Maja; Rantalainen, Mattias; Holmes, Chris C; Barrett, Amy; Uhlén, Mathias; Nilsson, Peter; Spector, Tim D; Schwenk, Jochen M. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Science. 2011;9( 22093360):73. PubMed |
| Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476. PubMed |

![Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18<br/>Lane 2: Human cell line RT-4](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/41405/17871/atl-hpa002549_anti-apoa4-pab-atl-hpa002549-wenhanced-validation_28473__83784.1783622783.jpg?compression=lossy)

![Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18<br/>Lane 2: Human cell line RT-4](https://cdn11.bigcommerce.com/s-nqdal6gcku/images/stencil/3840w/products/41405/17871/atl-hpa002549_anti-apoa4-pab-atl-hpa002549-wenhanced-validation_28473__83784.1783622783.jpg?compression=lossy)
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DKLGEVNTYAGDLQKKLVPFATELHERLAKDSEKLKEEIGKELEELRARLLPHANEVSQKIGDNLRELQQRLEPYADQLRTQVNTQAEQLRRQLTPYAQRMERVLRENADSLQASLRPHADELKAKIDQNVEELKGRLTPYADEFKVK |
| Gene Sequence | DKLGEVNTYAGDLQKKLVPFATELHERLAKDSEKLKEEIGKELEELRARLLPHANEVSQKIGDNLRELQQRLEPYADQLRTQVNTQAEQLRRQLTPYAQRMERVLRENADSLQASLRPHADELKAKIDQNVEELKGRLTPYADEFKVK |
| Gene ID - Mouse | ENSMUSG00000032080 |
| Gene ID - Rat | ENSRNOG00000055909 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti APOA4 pAb (ATL-HPA002549 w/enhanced validation) | |
| Datasheet | Anti APOA4 pAb (ATL-HPA002549 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti APOA4 pAb (ATL-HPA002549 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti APOA4 pAb (ATL-HPA002549 w/enhanced validation) | |
| Datasheet | Anti APOA4 pAb (ATL-HPA002549 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti APOA4 pAb (ATL-HPA002549 w/enhanced validation) |
| Citations for Anti APOA4 pAb (ATL-HPA002549 w/enhanced validation) – 2 Found |
| Kato, Bernet S; Nicholson, George; Neiman, Maja; Rantalainen, Mattias; Holmes, Chris C; Barrett, Amy; Uhlén, Mathias; Nilsson, Peter; Spector, Tim D; Schwenk, Jochen M. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Science. 2011;9( 22093360):73. PubMed |
| Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476. PubMed |