Loading...
Loading...
Loading...
Loading...
No reviews have been added for this product.
Atlas Antibodies


| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKE |
| Gene Sequence | PDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKE |
| Gene ID - Mouse | ENSMUSG00000040564 |
| Gene ID - Rat | ENSRNOG00000051439 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti APOC1 pAb (ATL-HPA051518) | |
| Datasheet | Anti APOC1 pAb (ATL-HPA051518) Datasheet (External Link) |
| Vendor Page | Anti APOC1 pAb (ATL-HPA051518) at Atlas Antibodies |
| Documents & Links for Anti APOC1 pAb (ATL-HPA051518) | |
| Datasheet | Anti APOC1 pAb (ATL-HPA051518) Datasheet (External Link) |
| Vendor Page | Anti APOC1 pAb (ATL-HPA051518) |
| Citations for Anti APOC1 pAb (ATL-HPA051518) – 2 Found |
| Evangelou, Petros; Groll, Mathias; Oppermann, Henry; Gaunitz, Frank; Eisenlöffel, Christian; Müller, Wolf; Eschrich, Klaus; Schänzer, Anne; Nestler, Ulf. Assessment of ApoC1, LuzP6, C12orf75 and OCC-1 in cystic glioblastoma using MALDI-TOF mass spectrometry, immunohistochemistry and qRT-PCR. Medical Molecular Morphology. 2019;52(4):217-225. PubMed |
| Lind, Anne-Li; Just, David; Mikus, Maria; Fredolini, Claudia; Ioannou, Marina; Gerdle, Björn; Ghafouri, Bijar; Bäckryd, Emmanuel; Tanum, Lars; Gordh, Torsten; Månberg, Anna. CSF levels of apolipoprotein C1 and autotaxin found to associate with neuropathic pain and fibromyalgia. Journal Of Pain Research. 12( 31686904):2875-2889. PubMed |
Try browsing our complete catalog of products.
Atlas Antibodies


| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKE |
| Gene Sequence | PDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKE |
| Gene ID - Mouse | ENSMUSG00000040564 |
| Gene ID - Rat | ENSRNOG00000051439 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti APOC1 pAb (ATL-HPA051518) | |
| Datasheet | Anti APOC1 pAb (ATL-HPA051518) Datasheet (External Link) |
| Vendor Page | Anti APOC1 pAb (ATL-HPA051518) at Atlas Antibodies |
| Documents & Links for Anti APOC1 pAb (ATL-HPA051518) | |
| Datasheet | Anti APOC1 pAb (ATL-HPA051518) Datasheet (External Link) |
| Vendor Page | Anti APOC1 pAb (ATL-HPA051518) |
| Citations for Anti APOC1 pAb (ATL-HPA051518) – 2 Found |
| Evangelou, Petros; Groll, Mathias; Oppermann, Henry; Gaunitz, Frank; Eisenlöffel, Christian; Müller, Wolf; Eschrich, Klaus; Schänzer, Anne; Nestler, Ulf. Assessment of ApoC1, LuzP6, C12orf75 and OCC-1 in cystic glioblastoma using MALDI-TOF mass spectrometry, immunohistochemistry and qRT-PCR. Medical Molecular Morphology. 2019;52(4):217-225. PubMed |
| Lind, Anne-Li; Just, David; Mikus, Maria; Fredolini, Claudia; Ioannou, Marina; Gerdle, Björn; Ghafouri, Bijar; Bäckryd, Emmanuel; Tanum, Lars; Gordh, Torsten; Månberg, Anna. CSF levels of apolipoprotein C1 and autotaxin found to associate with neuropathic pain and fibromyalgia. Journal Of Pain Research. 12( 31686904):2875-2889. PubMed |